Potri.002G040550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31280 49 / 3e-10 bHLH bHLH155 ,CPuORF7 conserved peptide upstream open reading frame 7 (.1.2.3.4)
AT1G06149 47 / 8e-10 CPuORF8 conserved peptide upstream open reading frame 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G222550 75 / 1e-20 AT2G31280 49 / 3e-10 conserved peptide upstream open reading frame 7 (.1.2.3.4)
Potri.006G090033 47 / 8e-10 AT2G31280 42 / 6e-08 conserved peptide upstream open reading frame 7 (.1.2.3.4)
Potri.001G216800 34 / 0.0002 AT2G27228 56 / 3e-13 conserved peptide upstream open reading frame 6 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G040550.1 pacid=42777227 polypeptide=Potri.002G040550.1.p locus=Potri.002G040550 ID=Potri.002G040550.1.v4.1 annot-version=v4.1
ATGAGTGAGGGAATGGGTAGAGATCGCCTGCTTTTGGCTACAGTAGGACCACCGATAAAAGCAAGAGCTGGGTTAAGGAGAAAACAGGCAGGAAGAGGAT
CTTATAGAGGAAGCTAG
AA sequence
>Potri.002G040550.1 pacid=42777227 polypeptide=Potri.002G040550.1.p locus=Potri.002G040550 ID=Potri.002G040550.1.v4.1 annot-version=v4.1
MSEGMGRDRLLLATVGPPIKARAGLRRKQAGRGSYRGS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.002G040550 0 1
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.005G222550 1.00 0.9095
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.007G113150 6.48 0.8080
AT2G16880 Pentatricopeptide repeat (PPR)... Potri.008G044050 7.34 0.8067
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.001G216800 8.94 0.8060
AT5G14280 GeBP DNA-binding storekeeper protei... Potri.010G056000 10.48 0.7951
AT2G31280 bHLH bHLH155 ,CPuORF... conserved peptide upstream ope... Potri.006G090033 11.48 0.7821
Potri.005G187000 11.53 0.7769
Potri.010G080633 13.26 0.7743
AT2G27228 CPuORF6 conserved peptide upstream ope... Potri.009G017600 14.14 0.7504
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.005G158000 14.69 0.7411

Potri.002G040550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.