Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BET11.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58170 202 / 7e-69 ATBET11, ATBS14A ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) AT4G14455 149 / 2e-47 ATBS14B ,ATBET12 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G221600 [exp] 235 / 1e-81 AT3G58170 206 / 4e-70 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Potri.010G074100 [exp] 155 / 3e-50 AT4G14455 147 / 1e-46 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) Potri.008G164600 [exp] 36 / 0.0007 ND /
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033868 [exp] 202 / 1e-68 AT3G58170 187 / 1e-62 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Lus10024876 [exp] 206 / 3e-63 AT3G12770 886 / 0.0 mitochondrial editing factor 22 (.1) Lus10041158 [exp] 145 / 1e-45 AT4G14455 164 / 6e-53 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) Lus10000706 [exp] 153 / 3e-44 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1) Lus10021879 [exp] 100 / 5e-28 AT4G14455 110 / 4e-32 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14BB, Target SNARE coiled-coil domain protein (.1) Lus10014756 [exp] 96 / 4e-24 AT5G11010 440 / 2e-152 Pre-mRNA cleavage complex II protein family (.1.2.3) Lus10009926 [exp] 87 / 2e-23 AT3G58170 81 / 6e-21 ARABIDOPSIS THALIANA BET1P/SFT1P-LIKE PROTEIN 14A, BET1P/SFT1P-like protein 14A (.1) Lus10018642 [exp] 41 / 7e-05 AT1G28490 334 / 7e-117 syntaxin of plants 61 (.1.2) Lus10017686 [exp] 39 / 0.0003 AT1G28490 299 / 8e-103 syntaxin of plants 61 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G041500.6 pacid=42780194 polypeptide=Potri.002G041500.6.p locus=Potri.002G041500 ID=Potri.002G041500.6.v4.1 annot-version=v4.1 ATGAATTCGCGGAGGGATGTTCGTAACAATAGGGCTGCTCTTTTTGATGGCATTGAGGAGGGTGGCATCAGAGCTTCATCCTCATACTCCTCCCATGAGA TTGATGAGCAAGATAATGAAAGAGCTTTGGAAGGGTTGGAGGATAGAGTCAGTCTGCTGAAGAGACTGTCAGGAGATATAAACGAAGAGGTGGACAGCCA TAATCTTATGCTAGACAGAATGGGCAATGATATGGATTCTTCCAGGGGAGTGCTGTCAGGAACCATGGATCGCTTTAAGATGGTATTTGAAACCAAATCA AGCCGTAGAATGCTTACACTCGTGGCGTCATTTGTGGTCATATTCCTAATTATATACTATCTCACTAGGTAA
AA sequence Show only first row Show all	>Potri.002G041500.6 pacid=42780194 polypeptide=Potri.002G041500.6.p locus=Potri.002G041500 ID=Potri.002G041500.6.v4.1 annot-version=v4.1 MNSRRDVRNNRAALFDGIEEGGIRASSSYSSHEIDEQDNERALEGLEDRVSLLKRLSGDINEEVDSHNLMLDRMGNDMDSSRGVLSGTMDRFKMVFETKS SRRMLTLVASFVVIFLIIYYLTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G58170		ATBET11, ATBS14...	ARABIDOPSIS THALIANA BET1P/SFT...		Potri.002G041500 [exp]	0	1	Pt-BET11.2
AT3G25590			unknown protein		Potri.008G109600 [exp]	1.41	0.8873
AT4G36760		ATAPP1	ARABIDOPSIS THALIANA AMINOPEPT...		Potri.018G145576 [exp]	2.00	0.8674
AT5G25630			Tetratricopeptide repeat (TPR)...		Potri.006G242600 [exp]	4.89	0.8556
AT2G33990		IQD9	IQ-domain 9 (.1)		Potri.011G063200 [exp]	5.65	0.8759
AT1G77710			unknown protein		Potri.005G173800 [exp]	6.48	0.8545
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.016G098200 [exp]	7.87	0.8379	Pt-TIP2.8
AT2G40770			zinc ion binding;DNA binding;h...		Potri.019G060126 [exp]	8.12	0.8700
AT5G25170			PPPDE putative thiol peptidase...		Potri.018G021700 [exp]	11.61	0.8433
AT5G20710		BGAL7	beta-galactosidase 7 (.1)		Potri.006G139100 [exp]	11.74	0.8140
AT5G38630		ACYB-1	cytochrome B561-1 (.1)		Potri.017G111700 [exp]	12.48	0.8433

Compare expression of checked genes

Potri.002G041500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.