Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55190 129 / 9e-38 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT5G05380 126 / 2e-36 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT2G38360 126 / 2e-36 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT1G04260 122 / 2e-35 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT2G40380 121 / 2e-34 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT3G56110 120 / 5e-34 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT5G01640 120 / 6e-34 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT1G08770 115 / 5e-32 PRA1.E prenylated RAB acceptor 1.E (.1) AT3G13710 109 / 3e-30 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT3G13720 106 / 8e-29 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G219100 [exp] 253 / 2e-86 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 220 / 1e-73 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 185 / 2e-59 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.008G074000 [exp] 129 / 1e-37 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.008G074033 [exp] 129 / 1e-37 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.010G183300 [exp] 125 / 7e-36 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.016G126400 [exp] 117 / 6e-33 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.019G124100 [exp] 117 / 8e-33 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.006G104400 [exp] 115 / 4e-32 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014747 [exp] 170 / 1e-53 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 169 / 4e-53 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 161 / 6e-50 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10024861 [exp] 152 / 1e-46 AT1G08770 132 / 2e-38 prenylated RAB acceptor 1.E (.1) Lus10018774 [exp] 143 / 4e-43 AT1G08770 130 / 5e-38 prenylated RAB acceptor 1.E (.1) Lus10042535 [exp] 139 / 2e-41 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10026404 [exp] 138 / 7e-41 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 138 / 1e-40 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10005088 [exp] 122 / 5e-35 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10034363 [exp] 120 / 4e-34 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.002G044000.1 pacid=42778277 polypeptide=Potri.002G044000.1.p locus=Potri.002G044000 ID=Potri.002G044000.1.v4.1 annot-version=v4.1 ATGAATTCTCCATCTCCAGCTTCGTACGGTTCCTTCCCACCCACCGAACCCTCGTCCACCTTCCTCACACGCGCCACCAATACGACATCCACCATCTTCG CCACCCGCCGCCCATGGCGCGAATTAATTGAATTCTCCTCCTTCGCGCGCCCAGGCTCCCTCGGCGATACCACAATCCGCATAAAACGGAACCTCTCCTA CTTTCGCGTTAATTACACAATGATAATCCTCTCTATCCTCTTCTTAAGCCTCTTATGGCACCCTCTCTCAATGATTGTCTTCTTGATCGTCTTCGTCGCC TGGTTTTTCCTTTACTTCTTTCGTGACCAGCCATTGGTGATTTTCCACCGCACGATTGATGATCGTGTGGTGCTTGGTTTGCTCGGTGTCGCTACTATTG TTGCTTTGATTTTCACACACGTGTGGTTAAATGTCTTGGTTTCGCTTTTGATTGGAGCTGCTATTGTTGTCTTGCACGCTGCGTTTAGAAGAACTGATGA TATGTATTCGGATGACCAAGATGTGGCTGATGGAAGTTTGCTGTCTTTTGTGGGGAGTCCTACGAGAGCGGGCCACGCTCGCTTTTAA
AA sequence Show only first row Show all	>Potri.002G044000.1 pacid=42778277 polypeptide=Potri.002G044000.1.p locus=Potri.002G044000 ID=Potri.002G044000.1.v4.1 annot-version=v4.1 MNSPSPASYGSFPPTEPSSTFLTRATNTTSTIFATRRPWRELIEFSSFARPGSLGDTTIRIKRNLSYFRVNYTMIILSILFLSLLWHPLSMIVFLIVFVA WFFLYFFRDQPLVIFHRTIDDRVVLGLLGVATIVALIFTHVWLNVLVSLLIGAAIVVLHAAFRRTDDMYSDDQDVADGSLLSFVGSPTRAGHARF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Potri.002G044000 [exp]	0	1
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Potri.009G041600 [exp]	5.00	0.8988
AT1G04530		TPR4	tetratricopeptide repeat 4, Te...		Potri.010G065400 [exp]	5.29	0.8390
AT2G41500		EMB2776, LIS	LACHESIS, WD-40 repeat family ...		Potri.006G045800 [exp]	5.29	0.8830
AT4G27540		PRA1.H	prenylated RAB acceptor 1.H (....		Potri.001G396900 [exp]	5.47	0.8717
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Potri.004G204300 [exp]	5.47	0.8911	IDH1.1
AT4G10790			UBX domain-containing protein ...		Potri.001G085600 [exp]	11.35	0.8858
AT3G22530			unknown protein		Potri.008G154100 [exp]	11.66	0.8682
AT5G56740		HAG02, HAC7, HA...	histone acetyltransferase of t...		Potri.013G068200 [exp]	12.04	0.8386
AT4G24500			hydroxyproline-rich glycoprote...		Potri.002G111500 [exp]	12.24	0.8399
AT1G09710	MYB		Homeodomain-like superfamily p...		Potri.002G106500 [exp]	12.64	0.8816

Compare expression of checked genes

Potri.002G044000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.