Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30570 120 / 8e-36 PSBW photosystem II reaction center W (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218800 [exp] 186 / 6e-62 AT2G30570 113 / 3e-33 photosystem II reaction center W (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014751 [exp] 121 / 4e-36 AT2G30570 134 / 3e-41 photosystem II reaction center W (.1) Lus10033862 [exp] 120 / 8e-36 AT2G30570 137 / 2e-42 photosystem II reaction center W (.1) Lus10024858 [exp] 105 / 3e-30 AT2G30570 132 / 1e-40 photosystem II reaction center W (.1) Lus10018771 [exp] 95 / 1e-26 AT2G30570 100 / 2e-29 photosystem II reaction center W (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07123 [poplar] [flax] PsbW Photosystem II reaction centre W protein (PsbW)
Representative CDS sequence Show only first row Show all	>Potri.002G044300.1 pacid=42776887 polypeptide=Potri.002G044300.1.p locus=Potri.002G044300 ID=Potri.002G044300.1.v4.1 annot-version=v4.1 ATGGCCACCATCACTGCTAGTACCGCTACATCATCAATCGTTCGTGCAGCCCTTGCACACAGGCCGTCTGTAGGAGTCTCTTCCTCACATGTTCTTGGCT TGCCCGCAATAGCAAAGAAGGGAAAAGTGAGCTGCTCCATGGAGGGAAAGCCTACTGTGGAGGAGGAAAAAAGCAAGGGAATGAGTGCATCATTGATGGC AGCTGTGTGTGCTGCAACCATATCAAGTCCAGCCTTGGCCCTGGTGGATGAGAGAATGTCCACCGAAGGAACAGGACTTCCCTTTGGTTTGAGCAACAAC CTTCTTGTTTGGATCCTGTTGGGTGTGTTTGCTTTCATCTGGTCTCTCTACTTTGTCTACACATCCTCCCTCGACGAGGATGAGGACTCAGGAATGTCCC TCTAA
AA sequence Show only first row Show all	>Potri.002G044300.1 pacid=42776887 polypeptide=Potri.002G044300.1.p locus=Potri.002G044300 ID=Potri.002G044300.1.v4.1 annot-version=v4.1 MATITASTATSSIVRAALAHRPSVGVSSSHVLGLPAIAKKGKVSCSMEGKPTVEEEKSKGMSASLMAAVCAATISSPALALVDERMSTEGTGLPFGLSNN LLVWILLGVFAFIWSLYFVYTSSLDEDEDSGMSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30570		PSBW	photosystem II reaction center...		Potri.002G044300 [exp]	0	1
AT1G74730			Protein of unknown function (D...		Potri.012G070600 [exp]	1.41	0.9938
AT1G30380		PSAK	photosystem I subunit K (.1)		Potri.018G027600 [exp]	2.00	0.9920	Pt-PSAK.1
AT2G06510		ATRPA70A, ATRPA...	ARABIDOPSIS THALIANA RPA70-KDA...		Potri.018G065300 [exp]	4.24	0.9864
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.011G079500 [exp]	4.47	0.9840	Lhcb1-1,Pt-LHB1.2
AT4G05180		PSII-Q, PSBQ, P...	photosystem II subunit Q-2 (.1...		Potri.011G031300 [exp]	5.65	0.9793	Pt-PSBQ2.2
AT4G13030			P-loop containing nucleoside t...		Potri.014G124300 [exp]	6.16	0.9644
AT2G36250		ATFTSZ2-1, FTSZ...	Tubulin/FtsZ family protein (....		Potri.009G164100 [exp]	6.24	0.9397	Pt-FTSZ2.2
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Potri.006G144100 [exp]	6.32	0.9834
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.001G210000 [exp]	6.48	0.9817	Pt-LHCB6.2,1
AT1G08380		PSAO	photosystem I subunit O (.1)		Potri.009G160800 [exp]	6.48	0.9803

Compare expression of checked genes

Potri.002G044300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.