Plant FIBer expression Database

Potri.002G044400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.002G044400.3 pacid=42778695 polypeptide=Potri.002G044400.3.p locus=Potri.002G044400 ID=Potri.002G044400.3.v4.1 annot-version=v4.1
ATGACATGTTTGCTTGAATGCATTGGAAAGGCCATTCATATCCCCCACGAAGTCGGGCTAATTTCTCCTCCAAGAACAAAAGACGATGGCAGATTGGTGT
CCAGATTTCCAAACAACAAAAGCCGAAGATTAGGTGTGGTTTACGGTTTCATGGCTACCCTGTTCGTCACTAATCCTAGCTGCACTCTTTACTCTTTTCT
ATCCATCAAACAAAAGCAACTTATGAGAGTCAAACAAGAGAGAAGAGGAGTTGGGAAGCAAGACAATACATAA
AA sequence
>Potri.002G044400.3 pacid=42778695 polypeptide=Potri.002G044400.3.p locus=Potri.002G044400 ID=Potri.002G044400.3.v4.1 annot-version=v4.1
MTCLLECIGKAIHIPHEVGLISPPRTKDDGRLVSRFPNNKSRRLGVVYGFMATLFVTNPSCTLYSFLSIKQKQLMRVKQERRGVGKQDNT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G044400
[exp]
0 1
AT5G44520 NagB/RpiA/CoA transferase-like... Potri.011G155500
[exp]
2.44 0.8398
AT3G47390 PHS1 PHOTOSENSITIVE 1, cytidine/deo... Potri.019G054000
[exp]
4.58 0.7711
AT1G44790 ChaC-like family protein (.1) Potri.005G176300
[exp]
9.38 0.7343
AT1G79040 PSBR photosystem II subunit R (.1) Potri.001G438800
[exp]
13.11 0.7859 Pt-PP1.2
AT1G30520 AAE14 acyl-activating enzyme 14 (.1) Potri.011G164100
[exp]
18.65 0.7721
AT2G25840 OVA4 ovule abortion 4, Nucleotidyly... Potri.003G158000
[exp]
18.70 0.7748
AT4G26555 FKBP-like peptidyl-prolyl cis-... Potri.001G467100
[exp]
24.73 0.7929
AT1G45474 LHCA5 photosystem I light harvesting... Potri.002G126600
[exp]
26.53 0.7686
AT1G66520 PDE194 pigment defective 194, formylt... Potri.017G123300
[exp]
29.66 0.7144
AT1G58200 MSL3 MSCS-like 3 (.1.2) Potri.005G154000
[exp]
44.32 0.7481

Potri.002G044400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.