Potri.002G047875 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19840 54 / 7e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G215200 162 / 8e-48 AT5G19840 579 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000493 78 / 4e-17 AT5G19840 545 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10014697 61 / 4e-11 AT5G19840 159 / 7e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info
Representative CDS sequence
>Potri.002G047875.1 pacid=42777647 polypeptide=Potri.002G047875.1.p locus=Potri.002G047875 ID=Potri.002G047875.1.v4.1 annot-version=v4.1
ATGTCTAATATGTTAGGGCACATGGATGCTTATTATTTGGGGAGAATACTAATAAGAACCAAGCACTCCCCAAGGCTTCTCCTGGCTCAGAGAAACTGGA
GGCATACATGTGAGCTGCTCCGTAATGGAGGAGGAGATCATGGGTGTTGTGACTCGAACATGTCATTCAAGAAACAGGGTTTACAAGGGCAGGACCAACA
GCAGAAAGTTAAATTGCATGAATTTGAACCACGTTCTCTCCAGGCTCTTCATGAACTTGTTTCTTTAGTTCTTGACTGTGTTCGTGTTAACATCACTGAC
CAAAGTCAATGCATACAATCAACCCCAACAAATGATTCTAAAGTTAGCATGAAAGATGAATGTGATGAAACTTTGACAACTAATTTATTTTTCTTAGAGG
ATAATCCAGTTGCTAAAATTCTTTGGACACTTGATCCGAGAACTCTTCAGAGCATCCTTCTTTCCATGGCGGCGAGTATGCTCTCCCTTATAAAGCTCCA
ATAG
AA sequence
>Potri.002G047875.1 pacid=42777647 polypeptide=Potri.002G047875.1.p locus=Potri.002G047875 ID=Potri.002G047875.1.v4.1 annot-version=v4.1
MSNMLGHMDAYYLGRILIRTKHSPRLLLAQRNWRHTCELLRNGGGDHGCCDSNMSFKKQGLQGQDQQQKVKLHEFEPRSLQALHELVSLVLDCVRVNITD
QSQCIQSTPTNDSKVSMKDECDETLTTNLFFLEDNPVAKILWTLDPRTLQSILLSMAASMLSLIKLQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G19840 2-oxoglutarate (2OG) and Fe(II... Potri.002G047875 0 1
AT3G02880 Leucine-rich repeat protein ki... Potri.004G066300 2.00 0.8894
Potri.011G153800 3.46 0.8123
AT4G20190 unknown protein Potri.003G156700 4.69 0.7722
AT3G51840 ATG6, ATSCX, AC... acyl-CoA oxidase 4 (.1) Potri.006G101800 5.29 0.7825 Pt-ACX4.1
AT4G22540 ORP2A OSBP(oxysterol binding protein... Potri.003G111600 7.93 0.8237
AT1G17810 BETA-TIP beta-tonoplast intrinsic prote... Potri.018G152100 13.60 0.7379 Pt-BETA-TIP.1
AT4G21780 unknown protein Potri.011G000400 18.00 0.7771
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Potri.017G135800 31.84 0.7674
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Potri.011G043700 36.02 0.7271
AT3G47890 Ubiquitin carboxyl-terminal hy... Potri.017G089250 36.85 0.7656

Potri.002G047875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.