Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03150 287 / 4e-101 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT5G13780 87 / 5e-22 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT5G16800 42 / 3e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) AT2G38130 39 / 0.0004 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G210400 [exp] 287 / 4e-101 AT1G03150 350 / 2e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.009G056600 [exp] 90 / 6e-23 AT5G13780 307 / 5e-108 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.001G261800 [exp] 86 / 2e-21 AT5G13780 301 / 8e-106 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.006G142100 [exp] 49 / 2e-07 AT2G06025 347 / 1e-120 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042595 [exp] 286 / 7e-101 AT1G03150 348 / 6e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10022048 [exp] 271 / 6e-95 AT1G03150 333 / 6e-119 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10016378 [exp] 86 / 1e-21 AT5G13780 292 / 5e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0257 [poplar] [flax] Acetyltrans PF00583 [poplar] [flax] Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence Show only first row Show all	>Potri.002G052000.4 pacid=42777184 polypeptide=Potri.002G052000.4.p locus=Potri.002G052000 ID=Potri.002G052000.4.v4.1 annot-version=v4.1 ATGTCATTCTACATGACTTATTCGGCAAGATGGCCCGATTATTTCCATGTTGCTGAAGGCCCTGTAAACAAAATCGTGGGCTACATAATGGGGAAAGTAG AAGGACAAGGCGAGTCGTGGCATGGTCATGTGACAGCAGTAACTGTGGCTACAGAATACCGCAGGCAGCAGTTGGCTAAGAAACTTTTGAATCTATTGGA AGATATCAGCGACAAGATTGATAAGGCTTATTTTGTAGATCTTTTTGTGAGAGCATCAAATACACCAGCCATAAAGATGTATGAGAAGCTTGGGTATGTA ATCTATAGAAGGGTGCTGCGCTATTATTCAGGGGAGGAAGATGGATTAGATATGAGGAAAGCTTTATCTAGAGACGTTGAAAAGAAATCCACTATCCCCC TCAAGCGGCCGGTTACTCCTGATGAATTGGAGTATGATTAA
AA sequence Show only first row Show all	>Potri.002G052000.4 pacid=42777184 polypeptide=Potri.002G052000.4.p locus=Potri.002G052000 ID=Potri.002G052000.4.v4.1 annot-version=v4.1 MSFYMTYSARWPDYFHVAEGPVNKIVGYIMGKVEGQGESWHGHVTAVTVATEYRRQQLAKKLLNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLGYV IYRRVLRYYSGEEDGLDMRKALSRDVEKKSTIPLKRPVTPDELEYD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G03150			Acyl-CoA N-acyltransferases (N...		Potri.002G052000 [exp]	0	1
AT1G67025			unknown protein		Potri.017G117230 [exp]	4.69	0.9266
					Potri.005G196000 [exp]	13.41	0.8747
AT2G26530		AR781	Protein of unknown function (D...		Potri.001G274000 [exp]	14.96	0.9209
AT1G02140		MAGO, HAP1, MEE...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.014G049700 [exp]	17.57	0.8640
AT1G10280			Core-2/I-branching beta-1,6-N-...		Potri.004G228100 [exp]	17.66	0.9165
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Potri.017G014600 [exp]	19.59	0.8713
AT1G67540			unknown protein		Potri.010G057800 [exp]	19.62	0.8951
AT1G79070			SNARE-associated protein-relat...		Potri.008G043200 [exp]	24.81	0.8756
AT1G08650		ATPPCK1, PPCK1	phosphoenolpyruvate carboxylas...		Potri.010G071400 [exp]	25.51	0.9185
AT2G38890			unknown protein		Potri.008G044500 [exp]	27.54	0.9129

Compare expression of checked genes

Potri.002G052000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.