Potri.002G055600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
AT2G46170 213 / 3e-69 Reticulon family protein (.1.2)
AT3G61560 207 / 7e-67 Reticulon family protein (.1.2)
AT1G64090 201 / 1e-64 RTNLB3 Reticulan like protein B3 (.1.2)
AT4G11220 201 / 3e-64 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
AT4G23630 201 / 4e-64 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
AT5G41600 197 / 7e-63 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
AT3G18260 176 / 4e-55 Reticulon family protein (.1)
AT4G01230 156 / 4e-47 Reticulon family protein (.1)
AT3G10915 130 / 3e-37 Reticulon family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G206800 395 / 3e-141 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3)
Potri.003G133600 234 / 3e-77 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.001G097700 232 / 2e-76 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.015G027300 229 / 3e-75 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.014G091200 225 / 5e-74 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2)
Potri.012G035600 221 / 3e-72 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.002G165400 217 / 8e-71 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2)
Potri.013G160900 183 / 1e-57 AT4G11220 193 / 4e-61 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
Potri.012G054100 158 / 5e-48 AT3G18260 238 / 6e-80 Reticulon family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029822 356 / 1e-125 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
Lus10020718 351 / 1e-123 AT3G10260 325 / 2e-113 Reticulon family protein (.1.2.3)
Lus10038833 226 / 2e-74 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
Lus10014948 226 / 3e-74 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Lus10027548 224 / 2e-73 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2)
Lus10032313 224 / 5e-73 AT4G23630 318 / 1e-109 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Lus10027546 220 / 1e-71 AT4G11220 307 / 5e-106 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
Lus10036405 211 / 4e-68 AT2G46170 320 / 8e-111 Reticulon family protein (.1.2)
Lus10039307 211 / 5e-68 AT1G64090 307 / 4e-106 Reticulan like protein B3 (.1.2)
Lus10041080 209 / 1e-67 AT2G46170 320 / 5e-111 Reticulon family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF02453 Reticulon Reticulon
Representative CDS sequence
>Potri.002G055600.1 pacid=42780154 polypeptide=Potri.002G055600.1.p locus=Potri.002G055600 ID=Potri.002G055600.1.v4.1 annot-version=v4.1
ATGCCTGAGAAGATAACAGCAGAAAGCCTTTTCAGCAATCTAGTAGAAACTATTGCTGATAATGTTCCGAAGCAGAAATCCGTGTCGTTTTTTGAGGAAG
GGGAAGAATCTGTCACTTCTCGTATCAACCGTCTGTTTGGGCGACAGAAGCCTGTCCACCATATTTTGGGAGGTGGAAAATCTGCTGATGTTCTCTTATG
GAGGAACAAGAAGATCTCAGCTGGTGTCTTAACCGGGGCAACAGCCATCTGGGTGCTCTTTGAATGGCTTAACTACCATCTCTTGTCTCTTGTATGCTTT
GCTCTGGCTCTTGGTATGCTGGCCCAATTTGTTTGGATAAATGCTTCGGGCCTAATGAACAGGTCTCCATCTCAGGTTCCTCGCCTTGTACTACCTGATG
ATATATTTGTCAGCATTGGCAGATCAATTGGTGCTGAGGTTAACCGTGCTTTGCTGTTTCTTCAGGATTTGTCATGTGGAGGAAACTTGAAACAGTTTCT
TGCGGCTATAGTAAGCTTGTGGGTTGCTGCAATTATTGGGAGCTGGTGCAACTTTTTAACTGTTATGTATATTGGTTTTGTTGCTGCCCACACATTGCCA
GTCCTGTATGAGAGATATGAAGATCAAGTAGATGATTTTGTGTTCAAGGCATTTGATCAGCTCCGAAATAACTACCAAAAGCTTGATGCCGGTGTCCTCG
GTAAGATCCCCAAAGGAAAGTTCAATGGAAAGAAGCATGAATAG
AA sequence
>Potri.002G055600.1 pacid=42780154 polypeptide=Potri.002G055600.1.p locus=Potri.002G055600 ID=Potri.002G055600.1.v4.1 annot-version=v4.1
MPEKITAESLFSNLVETIADNVPKQKSVSFFEEGEESVTSRINRLFGRQKPVHHILGGGKSADVLLWRNKKISAGVLTGATAIWVLFEWLNYHLLSLVCF
ALALGMLAQFVWINASGLMNRSPSQVPRLVLPDDIFVSIGRSIGAEVNRALLFLQDLSCGGNLKQFLAAIVSLWVAAIIGSWCNFLTVMYIGFVAAHTLP
VLYERYEDQVDDFVFKAFDQLRNNYQKLDAGVLGKIPKGKFNGKKHE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G10260 Reticulon family protein (.1.2... Potri.002G055600 0 1
AT3G55960 Haloacid dehalogenase-like hyd... Potri.010G188500 2.23 0.8515
AT4G11820 FKP1, EMB2778, ... FLAKY POLLEN 1, hydroxymethylg... Potri.003G120300 3.31 0.8240
AT1G76390 PUB43 plant U-box 43, ARM repeat sup... Potri.012G019900 3.31 0.8665
AT1G79590 ATSYP52, SYP52 syntaxin of plants 52 (.1.2) Potri.006G032800 4.24 0.8639
AT2G44350 CSY4, ATCS CITRATE SYNTHASE 4, Citrate sy... Potri.001G230500 6.00 0.8195 ATCS.2
AT4G28070 AFG1-like ATPase family protei... Potri.018G100900 6.24 0.8212
AT5G10870 ATCM2 chorismate mutase 2 (.1) Potri.018G019250 8.94 0.7974
AT3G59880 unknown protein Potri.017G002100 11.83 0.8212
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Potri.002G056500 14.00 0.8537
AT3G12570 FYD FYD (.1.2.3.4) Potri.008G054100 14.14 0.8152

Potri.002G055600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.