Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS12.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32060 201 / 9e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) AT1G15930 197 / 6e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G206300 [exp] 275 / 7e-97 AT2G32060 201 / 2e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Potri.003G181200 [exp] 230 / 4e-79 AT2G32060 188 / 1e-62 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Potri.001G046600 [exp] 226 / 2e-77 AT2G32060 194 / 8e-65 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027800 [exp] 235 / 8e-81 AT2G32060 197 / 3e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Lus10021027 [exp] 232 / 1e-79 AT2G32060 192 / 4e-64 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Lus10035501 [exp] 224 / 3e-72 AT3G12150 333 / 3e-111 unknown protein Lus10023825 [exp] 206 / 3e-68 AT2G32060 168 / 3e-53 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [poplar] [flax] PELOTA PF01248 [poplar] [flax] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Potri.002G056200.1 pacid=42778385 polypeptide=Potri.002G056200.1.p locus=Potri.002G056200 ID=Potri.002G056200.1.v4.1 annot-version=v4.1 ATGTCTGGTGAAGAAGGTGCTGTTGCTCAGACTGAGACTCCAGCTGTTGCTGATGTACCACCACTTGGTGAGCCAATGGACTTGATGACAGCATTGCAGC TTGTGCTGAGAAAATCTCTGGCTCATGGTGGGCTTTCTCGAGGTCTTCATGAAGGTGCCAAAGTGATTGAGAAGCATGCTGCTCAACTTTGTGTCTTGGC AGAGGATTGCAACCAGCCTGACTATGTTAAACTTGTTAAGGCACTTTGTGCTGATCACAACGTGAACTTGCTAACTGTTCCAAGTGCAAAAACCCTCGGA GAGTGGGCTGGTTTGTGTAAGATTGACTCAGAGGGGAAGGCTAGGAAAGTGGTCGGTTGCTCGTGTGTTGTTGTGAAGGATTTTGGGGAGGACACTGAAG CTCTTAATGTCATTCAACAGCATGTCAAGGCCAACTAA
AA sequence Show only first row Show all	>Potri.002G056200.1 pacid=42778385 polypeptide=Potri.002G056200.1.p locus=Potri.002G056200 ID=Potri.002G056200.1.v4.1 annot-version=v4.1 MSGEEGAVAQTETPAVADVPPLGEPMDLMTALQLVLRKSLAHGGLSRGLHEGAKVIEKHAAQLCVLAEDCNQPDYVKLVKALCADHNVNLLTVPSAKTLG EWAGLCKIDSEGKARKVVGCSCVVVKDFGEDTEALNVIQQHVKAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.002G056200 [exp]	0	1	Pt-RPS12.2
AT3G56340			Ribosomal protein S26e family ...		Potri.013G093700 [exp]	1.73	0.9531	RPS26.1
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	3.00	0.9649	RPL35.1
AT5G39740		OLI7, RPL5B	OLIGOCELLULA 7, ribosomal prot...		Potri.019G099000 [exp]	4.24	0.9592
AT3G59540			Ribosomal L38e protein family ...		Potri.017G026000 [exp]	4.69	0.9379
AT1G57860			Translation protein SH3-like f...		Potri.016G061100 [exp]	6.32	0.9510
AT3G05560			Ribosomal L22e protein family ...		Potri.013G015300 [exp]	6.48	0.9492	Pt-RPL22.3
AT4G00100		PFL2, ATRPS13A	POINTED FIRST LEAF 2, ribosoma...		Potri.012G128600 [exp]	8.94	0.9516	Pt-RPS13.2
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Potri.016G063200 [exp]	9.79	0.9489	Pt-RPS5.1
AT1G57720			Translation elongation factor ...		Potri.019G077000 [exp]	10.19	0.9357
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Potri.019G131900 [exp]	11.74	0.9371	Pt-RPL10.4

Compare expression of checked genes

Potri.002G056200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.