Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR13
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12830 65 / 9e-15 SAUR-like auxin-responsive protein family (.1) AT1G56150 64 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT1G16510 57 / 1e-11 SAUR-like auxin-responsive protein family (.1) AT1G79130 54 / 2e-10 SAUR-like auxin-responsive protein family (.1) AT1G76190 49 / 2e-08 SAUR-like auxin-responsive protein family (.1) AT3G43120 49 / 2e-08 SAUR-like auxin-responsive protein family (.1) AT2G24400 48 / 5e-08 SAUR-like auxin-responsive protein family (.1) AT3G61900 47 / 5e-08 SAUR-like auxin-responsive protein family (.1) AT2G46690 47 / 7e-08 SAUR-like auxin-responsive protein family (.1) AT4G31320 47 / 9e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G096400 [exp] 60 / 8e-13 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.019G082100 [exp] 56 / 8e-12 AT4G09530 85 / 3e-23 SAUR-like auxin-responsive protein family (.1) Potri.007G067800 [exp] 57 / 1e-11 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1) Potri.013G111000 [exp] 55 / 2e-11 AT4G09530 93 / 3e-26 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 56 / 4e-11 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.008G003900 [exp] 54 / 2e-10 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 54 / 4e-10 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 49 / 1e-08 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.003G070900 [exp] 49 / 1e-08 AT3G12830 54 / 3e-10 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031754 [exp] 64 / 4e-14 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 63 / 1e-13 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10040643 [exp] 58 / 1e-11 AT1G16510 91 / 8e-24 SAUR-like auxin-responsive protein family (.1) Lus10018269 [exp] 57 / 3e-11 AT1G16510 92 / 4e-24 SAUR-like auxin-responsive protein family (.1) Lus10001397 [exp] 55 / 7e-11 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10037302 [exp] 56 / 3e-10 AT2G24400 150 / 2e-44 SAUR-like auxin-responsive protein family (.1) Lus10035716 [exp] 53 / 1e-09 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 50 / 6e-09 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2) Lus10026977 [exp] 51 / 7e-09 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10026532 [exp] 49 / 1e-08 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.002G057500.1 pacid=42777995 polypeptide=Potri.002G057500.1.p locus=Potri.002G057500 ID=Potri.002G057500.1.v4.1 annot-version=v4.1 ATGCAAACAATGAGAGCTTCCATCTCTTCGACTTCCTATGTGAGATTAGACAGGGACGGGATGAGTGAGAAGATGAAGCTCGACCACAAAAAAGGTGTTT TTCCAGTTCTGGTAGGCAACGAGGGGATGATGGAGAGATTTTTGCTACCCACGAGGTTAACCAAGCATCCTTTCATTGTTCAGCTGCTCGAGATGTCAGC TCAAGAATACGGGCTCGAGCAAGAGGGATTGCTGAAGATCCCATACGATGCTAGCTGCTTTGAAAAGATGCTCAAGCTCATATCCAAGAAATAG
AA sequence Show only first row Show all	>Potri.002G057500.1 pacid=42777995 polypeptide=Potri.002G057500.1.p locus=Potri.002G057500 ID=Potri.002G057500.1.v4.1 annot-version=v4.1 MQTMRASISSTSYVRLDRDGMSEKMKLDHKKGVFPVLVGNEGMMERFLLPTRLTKHPFIVQLLEMSAQEYGLEQEGLLKIPYDASCFEKMLKLISKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G12830			SAUR-like auxin-responsive pro...		Potri.002G057500 [exp]	0	1	SAUR13
AT5G05340			Peroxidase superfamily protein...		Potri.006G107000 [exp]	1.73	0.9704	PRX1.13
AT1G52780			Protein of unknown function (D...		Potri.006G187000 [exp]	2.44	0.9649
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029200 [exp]	5.47	0.9632
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G175300 [exp]	6.92	0.9631
AT2G20030			RING/U-box superfamily protein...		Potri.006G239500 [exp]	7.34	0.9608
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.019G080500 [exp]	8.36	0.9620	CYP716B4
AT2G31090			unknown protein		Potri.011G063900 [exp]	8.71	0.9531
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Potri.003G156200 [exp]	9.48	0.9573
AT5G51160			Ankyrin repeat family protein ...		Potri.012G113800 [exp]	10.39	0.9592
AT1G52340		SIS4, SDR1, ISI...	SHORT-CHAIN DEHYDROGENASE REDU...		Potri.016G074000 [exp]	12.32	0.9593

Compare expression of checked genes

Potri.002G057500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.