Plant FIBer expression Database

RPL18.7 (Potri.002G057600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL18.7
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34480 342 / 3e-122 Ribosomal protein L18ae/LX family protein (.1)
AT3G14600 339 / 4e-121 Ribosomal protein L18ae/LX family protein (.1)
AT1G29965 332 / 3e-118 Ribosomal protein L18ae/LX family protein (.1)
AT1G29970 329 / 5e-115 RPL18AA 60S ribosomal protein L18A-1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G063400
[exp]
359 / 6e-129 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.004G063300
[exp]
359 / 6e-129 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.011G072400
[exp]
358 / 7e-129 AT2G34480 349 / 4e-125 Ribosomal protein L18ae/LX family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023457
[exp]
357 / 3e-128 AT2G34480 337 / 2e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10019881
[exp]
356 / 1e-127 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10023454
[exp]
356 / 1e-127 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10014035
[exp]
358 / 1e-125 AT2G34480 338 / 2e-117 Ribosomal protein L18ae/LX family protein (.1)
Lus10040332
[exp]
301 / 2e-106 AT2G34480 290 / 4e-102 Ribosomal protein L18ae/LX family protein (.1)
Lus10023456
[exp]
156 / 5e-50 AT2G34480 147 / 1e-46 Ribosomal protein L18ae/LX family protein (.1)
Lus10023453
[exp]
119 / 9e-36 AT2G34480 112 / 4e-33 Ribosomal protein L18ae/LX family protein (.1)
Lus10028130
[exp]
42 / 9e-05 AT1G29970 150 / 6e-45 60S ribosomal protein L18A-1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A
Representative CDS sequence
>Potri.002G057600.4 pacid=42780081 polypeptide=Potri.002G057600.4.p locus=Potri.002G057600 ID=Potri.002G057600.4.v4.1 annot-version=v4.1
ATGGTTTCTTTCAGGTTTCACCAGTACCAAGTGGTCGGGAGAGCACTTCCAACTGAGTCCGATGAGCATCCAAAGATCTACCGCATGAAGCTTTGGGCAA
CGAACGAGGTCCGTTCAAAATCAAAGTTCTGGTACTTCTTGAGGAAGCTTAAGAAGGTCAAGAAAAGCAATGGACAAATTCTTGCCATCAATGAGATTTT
TGAGAAGAATCCTACCAAGATCAAGAACTATGGAATATGGCTGCGATACCAGAGCAGAACTGGTTATCACAACATGTACAAGGAATACAGGGATACAACT
CTGAATGGTGCTGTTGAACAGATGTACAACGAGATGGCATCTCGCCACAGGGTTAGGTCACCATGCATCCAGATCATCAAGACTGCTACCATCCCTGCAA
AGCTTTGCAAGAGAGAGAGTACCAAGCAGTTCCACAATTCCAAAATCAAGTTCCCATTGGTGTTCAAGAAGGTTAGACCCCCAACCAGGAAGCTCAAGAC
AACATACAAGGCATCCAGGCCCAACCTGTTTATGTAA
AA sequence
>Potri.002G057600.4 pacid=42780081 polypeptide=Potri.002G057600.4.p locus=Potri.002G057600 ID=Potri.002G057600.4.v4.1 annot-version=v4.1
MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTT
LNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.002G057600
[exp]
0 1 RPL18.7
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Potri.017G101000
[exp]
1.00 0.9791 Pt-RPL7.7
AT5G45775 Ribosomal L5P family protein (... Potri.011G068900
[exp]
1.73 0.9691 Pt-L16.1
AT5G60390 GTP binding Elongation factor ... Potri.008G042700
[exp]
3.00 0.9638 Pt-ADR12.2
AT5G39740 OLI7, RPL5B OLIGOCELLULA 7, ribosomal prot... Potri.019G099000
[exp]
3.46 0.9659
AT5G58420 Ribosomal protein S4 (RPS4A) f... Potri.006G103700
[exp]
4.58 0.9651
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400
[exp]
5.47 0.9706 RPL17.2
AT3G27080 TOM20-3 translocase of outer membrane ... Potri.003G173400
[exp]
5.83 0.9574 Pt-TOM20.2
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G072700
[exp]
6.48 0.9654
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500
[exp]
7.74 0.9654 ARP1.1
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.018G115400
[exp]
7.74 0.9583 Pt-RPS11.3

Potri.002G057600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.