Potri.002G057900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30890 190 / 6e-61 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT4G18260 192 / 6e-59 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT3G25290 52 / 5e-08 Auxin-responsive family protein (.1.2)
AT4G12980 52 / 5e-08 Auxin-responsive family protein (.1)
AT3G59070 50 / 1e-07 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G47530 50 / 2e-07 Auxin-responsive family protein (.1)
AT4G17280 49 / 4e-07 Auxin-responsive family protein (.1)
AT3G61750 45 / 1e-05 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G35735 44 / 3e-05 Auxin-responsive family protein (.1)
AT2G04850 42 / 8e-05 Auxin-responsive family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G204300 343 / 2e-121 AT2G30890 228 / 7e-75 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.011G080400 209 / 2e-68 AT4G18260 254 / 3e-81 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.002G222700 56 / 3e-09 AT5G35735 369 / 8e-126 Auxin-responsive family protein (.1)
Potri.013G118300 52 / 7e-08 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
Potri.019G096300 51 / 1e-07 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.002G249300 50 / 1e-07 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.019G096600 50 / 1e-07 AT5G47530 296 / 1e-97 Auxin-responsive family protein (.1)
Potri.019G095800 50 / 2e-07 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.001G031600 50 / 3e-07 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020757 248 / 1e-84 AT4G18260 184 / 6e-56 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10007333 246 / 6e-83 AT4G18260 204 / 2e-62 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10001162 51 / 1e-07 AT2G04850 563 / 0.0 Auxin-responsive family protein (.1)
Lus10006398 50 / 2e-07 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1)
Lus10012625 50 / 3e-07 AT3G61750 400 / 7e-138 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Lus10002274 50 / 3e-07 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10001736 50 / 4e-07 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Lus10010120 49 / 4e-07 AT3G61750 343 / 5e-117 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
Lus10012350 49 / 8e-07 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10038225 46 / 5e-06 AT3G25290 283 / 6e-95 Auxin-responsive family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Potri.002G057900.3 pacid=42778346 polypeptide=Potri.002G057900.3.p locus=Potri.002G057900 ID=Potri.002G057900.3.v4.1 annot-version=v4.1
ATGGGATTTCTAATGCCTGTTGGGGTGATCGCTATCAGAATGTCACACAGAGAGGCATGCGGACGACGGCTTAAGATTCTTTTCTATGTTCATTCCATTT
CGCAGCAGATGCTTTCTGTACTTCTCTCCACAGCGGGAGCAGTAATGTCTATAAAAAACTTCAACAACTCATTCGACAATCACCATCAACGAATAGGCGT
AGGCCTGTATGGTATGGTATGGTTACAAGCACTCATTGGGTTTCTACGACCGAGGAGAGGATCTAAAGGAAGAGGTCTGTGGTTTTTTGTGCACTGGATA
ACTGGAACTGCGGTATCTCTTTTGGGAATCGTCAACGTATACACAGGATTACAAGCTTACCATCAGAAAACATCAAGAAGAATACATATTTGGACTATAG
TTTTCACCACCGAGGTCTCTTTCATTATTTTCTTTTACCTGTTCCAAGACAAATGGGATTATATACATAAGCAAGGAGTCATTTTGGAACCATTGAGGCC
CACTCATCAAGTAATTTCTCCAGGAGAAAAGCAAAAGGGATCAACAACCGAGTCTTGCTGA
AA sequence
>Potri.002G057900.3 pacid=42778346 polypeptide=Potri.002G057900.3.p locus=Potri.002G057900 ID=Potri.002G057900.3.v4.1 annot-version=v4.1
MGFLMPVGVIAIRMSHREACGRRLKILFYVHSISQQMLSVLLSTAGAVMSIKNFNNSFDNHHQRIGVGLYGMVWLQALIGFLRPRRGSKGRGLWFFVHWI
TGTAVSLLGIVNVYTGLQAYHQKTSRRIHIWTIVFTTEVSFIIFFYLFQDKWDYIHKQGVILEPLRPTHQVISPGEKQKGSTTESC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30890 Cytochrome b561/ferric reducta... Potri.002G057900 0 1
AT2G45040 Matrixin family protein (.1) Potri.014G058200 1.00 0.9563
AT3G56750 unknown protein Potri.006G040400 2.44 0.9356
AT1G09540 MYB AtMYB61 ARABIDOPSIS THALIANA MYB DOMAI... Potri.005G001600 2.82 0.9385 MYB61.2
AT2G38370 Plant protein of unknown funct... Potri.016G133300 2.82 0.9312
AT2G45340 Leucine-rich repeat protein ki... Potri.002G147000 3.16 0.9306
AT3G25130 unknown protein Potri.002G246400 5.00 0.9369
AT5G42560 Abscisic acid-responsive (TB2/... Potri.005G237900 5.09 0.9497
AT5G66920 SKS17 SKU5 similar 17 (.1) Potri.007G038300 5.74 0.9416
AT3G06840 unknown protein Potri.001G162100 9.16 0.9256
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Potri.009G055900 10.24 0.9255

Potri.002G057900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.