Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58850 80 / 4e-20 HLH2, PAR2 phy rapidly regulated 2 (.1) AT2G42870 76 / 2e-18 PAR1 ,HLH1 HELIX-LOOP-HELIX 1, phy rapidly regulated 1 (.1) AT3G05800 43 / 2e-05 bHLH bHLH150, AIF1 AtBS1(activation-tagged BRI1 suppressor 1)-interacting factor 1 (.1) AT2G47270 40 / 4e-05 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) AT1G09250 41 / 6e-05 bHLH bHLH149, AIF4 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT4G30410 41 / 7e-05 sequence-specific DNA binding transcription factors (.1.2) AT3G29370 40 / 8e-05 P1R3 P1R3, unknown protein AT3G06590 41 / 9e-05 bHLH bHLH148, AIF2 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT3G17100 40 / 0.0002 bHLH bHLH147, AIF3 sequence-specific DNA binding transcription factors (.1.2) AT2G43060 39 / 0.0002 bHLH AtIBH1, bHLH158 ILI1 binding bHLH 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G201500 [exp] 215 / 3e-73 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1) Potri.002G193300 [exp] 65 / 5e-14 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.014G118300 [exp] 62 / 7e-13 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.005G012400 [exp] 44 / 5e-06 AT1G09250 109 / 1e-29 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.018G090200 [exp] 43 / 1e-05 AT2G18969 98 / 2e-25 unknown protein Potri.017G093000 [exp] 42 / 1e-05 AT5G39240 64 / 3e-14 unknown protein Potri.018G099100 [exp] 42 / 2e-05 AT4G30410 135 / 1e-40 sequence-specific DNA binding transcription factors (.1.2) Potri.013G007700 [exp] 42 / 2e-05 AT1G09250 95 / 4e-24 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.008G103500 [exp] 41 / 6e-05 AT3G17100 174 / 2e-54 sequence-specific DNA binding transcription factors (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026730 [exp] 50 / 2e-08 AT2G43060 97 / 4e-26 ILI1 binding bHLH 1 (.1) Lus10001447 [exp] 48 / 6e-08 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10002419 [exp] 46 / 2e-07 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10025511 [exp] 46 / 7e-07 AT2G43060 98 / 9e-27 ILI1 binding bHLH 1 (.1) Lus10030641 [exp] 43 / 4e-06 AT1G23965 42 / 3e-06 unknown protein Lus10030844 [exp] 40 / 4e-05 AT1G23965 48 / 2e-08 unknown protein Lus10017065 [exp] 41 / 7e-05 AT3G06590 171 / 1e-53 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10037783 [exp] 41 / 8e-05 AT3G06590 172 / 9e-54 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10015500 [exp] 40 / 0.0003 AT4G30410 114 / 6e-32 sequence-specific DNA binding transcription factors (.1.2) Lus10038432 [exp] 39 / 0.0008 AT1G30670 108 / 4e-28 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G060100.1 pacid=42779639 polypeptide=Potri.002G060100.1.p locus=Potri.002G060100 ID=Potri.002G060100.1.v4.1 annot-version=v4.1 ATGGAGGATAACTTAAACCAAGCAATGATACCCACATTTCATAAAAGAAAAGAAAGGAAAACCACCCACGAGAAATCTGAGATGGCAAAGCATGAATCTT TAGTTAGTTTGAAAAGGAGCAGGAGAGCAGAGAATGTTCACAAGAGAAGCAGAAGAAAGAGAGAGGAGATGTTAAAGGTTCAAGAAAAGGATCAAGCGTC GACGGTGGGTGCAGGTGAAGATGATGAGAAGGCAGAAGTAGATAGAAAGATTGTGGCATTGCAAATGATTATCCCAGGGGGCGAGTCGTTTGGGGTAGAC AAGTTGTTTGAAGAGACTGCTGATTATATAATGGCTTTGCAGTGTCAAATCAAAGCCATGAGAGTTCTTGCTGGTTTTCTTGAAGGTCTAGAAAAGGAAA AGAGGAAGTCTGGAGGTTAA
AA sequence Show only first row Show all	>Potri.002G060100.1 pacid=42779639 polypeptide=Potri.002G060100.1.p locus=Potri.002G060100 ID=Potri.002G060100.1.v4.1 annot-version=v4.1 MEDNLNQAMIPTFHKRKERKTTHEKSEMAKHESLVSLKRSRRAENVHKRSRRKREEMLKVQEKDQASTVGAGEDDEKAEVDRKIVALQMIIPGGESFGVD KLFEETADYIMALQCQIKAMRVLAGFLEGLEKEKRKSGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G58850		HLH2, PAR2	phy rapidly regulated 2 (.1)		Potri.002G060100 [exp]	0	1
AT3G58850		HLH2, PAR2	phy rapidly regulated 2 (.1)		Potri.005G201500 [exp]	1.00	0.8871
AT1G11915			unknown protein		Potri.011G007900 [exp]	2.44	0.8837
AT5G64667		IDL2	inflorescence deficient in abs...		Potri.005G057400 [exp]	7.74	0.8592
AT5G17330		GAD1, GAD	GLUTAMATE DECARBOXYLASE 1, glu...		Potri.004G075200 [exp]	7.93	0.8394	Pt-GAD.2
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.008G052100 [exp]	13.41	0.8254
AT5G06470			Glutaredoxin family protein (....		Potri.006G201300 [exp]	21.26	0.8576
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.006G121700 [exp]	21.56	0.8490	Pt-TIP2.7
AT1G53300		TTL1	tetratricopetide-repeat thiore...		Potri.011G111500 [exp]	23.83	0.8405
AT5G55650			unknown protein		Potri.001G367100 [exp]	26.53	0.8163
AT3G59110			Protein kinase superfamily pro...		Potri.005G203300 [exp]	26.83	0.8233

Compare expression of checked genes

Potri.002G060100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.