Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-EXT.12
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14130 424 / 4e-151 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT3G23730 417 / 2e-148 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G57560 387 / 2e-136 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT4G25810 383 / 7e-135 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57550 382 / 2e-134 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30270 363 / 5e-127 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G57540 357 / 9e-125 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G48070 357 / 1e-124 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT2G18800 357 / 4e-124 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT5G57530 356 / 4e-124 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G201250 [exp] 541 / 0 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 532 / 0 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 523 / 0 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.014G146100 [exp] 454 / 9e-163 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G236200 [exp] 454 / 1e-162 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 417 / 1e-147 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 415 / 2e-147 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 414 / 6e-147 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.011G077320 [exp] 410 / 1e-145 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010939 [exp] 445 / 2e-159 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 445 / 4e-159 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031393 [exp] 441 / 1e-157 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 439 / 7e-157 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 429 / 4e-153 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10003048 [exp] 426 / 1e-151 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 421 / 1e-149 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020773 [exp] 419 / 8e-149 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10034098 [exp] 418 / 2e-148 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020772 [exp] 415 / 3e-147 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.002G060500.1 pacid=42779374 polypeptide=Potri.002G060500.1.p locus=Potri.002G060500 ID=Potri.002G060500.1.v4.1 annot-version=v4.1 ATGTCGTTCGTTCGTTCGAGAAAGCTTTCTTCAATGCTTTTGTTTACTCTGTTATTTGCCTGTCTGATGGGAGCCTCCAAGGGTGGCAATTTCTTCCAAG ATTTTGACATCACCTGGGGCGATCAACGTGCTAAGATACTAAACGGTGGCCAACTTCTCACACTCTCTCTCGACAAGGCTTCTGGTTCTGGCTTTCAATC CAAGAATGAATACTTATTTGGCCAAATCGACATGCAAATCAAGCTAGTAGCAGGCAACTCGGCTGGTACTGTCACTGCATACTATCTATCTTCTCAAGGG TCGACCCACGATGAGATTGACTTTGAGTTTTTGGGGAATGCAACTGGAGAGCCATATATTCTCCATACCAATGTGTTCTCCCAGGGGAAAGGCAACAGAG AACAACAATTCTATCTCTGGTTTGATCCCACTAAGGCTTTCCACACCTACTCCATTGTGTGGAACCAACAACGCATTATTTTCTTAGTGGACAACATCCC AATAAGAGTGTTCCATAATCTGGAATCAATCGGTGTGCCATTCCCGAACAAGCAAGCCATGAGGATACATTCAAGTCTCTGGAATGCTGATGATTGGGCA ACAAGAGGGGGGCTTGTAAAGACTGACTGGACACAAGCTCCTTTCACTGCTTCTTACAGAAATTTCAAAGCCAATGCTTGTATTTGGTCATCTGCATCAC CTTGTACCTCCACCTCTCCCAATTCTGTGCAAGACAATGCCTGGCAAGTTCAAGCACTTGATGCCCCGGGGCGCAACAGACTTCGATGGGTGCAACAAAA GTACATGATTTACAACTACTGCACTGACTTGAAGCGGTTCCCTCAGGGTCTCCCACCTGAATGCAAGCGATCAAGATTTCTTTGA
AA sequence Show only first row Show all	>Potri.002G060500.1 pacid=42779374 polypeptide=Potri.002G060500.1.p locus=Potri.002G060500 ID=Potri.002G060500.1.v4.1 annot-version=v4.1 MSFVRSRKLSSMLLFTLLFACLMGASKGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKASGSGFQSKNEYLFGQIDMQIKLVAGNSAGTVTAYYLSSQG STHDEIDFEFLGNATGEPYILHTNVFSQGKGNREQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNLESIGVPFPNKQAMRIHSSLWNADDWA TRGGLVKTDWTQAPFTASYRNFKANACIWSSASPCTSTSPNSVQDNAWQVQALDAPGRNRLRWVQQKYMIYNYCTDLKRFPQGLPPECKRSRFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.002G060500 [exp]	0	1	Pt-EXT.12
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.002G060400 [exp]	1.00	0.9685
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.005G007200 [exp]	2.00	0.8966	EXT.9
AT1G45688			unknown protein		Potri.002G124600 [exp]	2.82	0.8602
AT5G38700			unknown protein		Potri.002G198800 [exp]	3.87	0.8497
					Potri.002G021150 [exp]	5.29	0.7578
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Potri.017G047800 [exp]	6.48	0.8268
AT1G76210			Arabidopsis protein of unknown...		Potri.002G012600 [exp]	8.48	0.7514
					Potri.019G125100 [exp]	8.94	0.7796
AT4G01580	B3		AP2/B3-like transcriptional fa...		Potri.007G035700 [exp]	9.94	0.7206
AT5G38700			unknown protein		Potri.014G123400 [exp]	14.42	0.7597

Compare expression of checked genes

Potri.002G060500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.