Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RAB7.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09720 375 / 1e-134 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 361 / 7e-129 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT1G52280 325 / 2e-114 AtRABG3d RAB GTPase homolog G3D (.1) AT3G16100 321 / 4e-113 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT3G18820 317 / 2e-111 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT2G21880 316 / 5e-111 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT1G49300 308 / 3e-108 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT5G39620 237 / 7e-80 AtRABG1 RAB GTPase homolog G1 (.1) AT5G47960 135 / 1e-39 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT3G12160 134 / 4e-39 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G198800 [exp] 404 / 4e-146 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 337 / 2e-119 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.004G153400 [exp] 323 / 5e-114 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.009G115000 [exp] 323 / 6e-114 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 305 / 1e-106 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 303 / 6e-106 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.007G079700 [exp] 287 / 3e-100 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.001G270100 [exp] 134 / 3e-39 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.003G086700 [exp] 133 / 4e-39 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028719 [exp] 372 / 2e-133 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 354 / 2e-126 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10035872 [exp] 323 / 6e-114 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 321 / 4e-113 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 291 / 6e-101 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 279 / 1e-96 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10025790 [exp] 189 / 4e-61 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10023829 [exp] 137 / 8e-39 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10015297 [exp] 131 / 5e-38 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10019501 [exp] 129 / 2e-37 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.002G062400.1 pacid=42778269 polypeptide=Potri.002G062400.1.p locus=Potri.002G062400 ID=Potri.002G062400.1.v4.1 annot-version=v4.1 ATGTCAACGCGTAGGCGTACCTTGCTCAAGGTCATCGTTCTCGGCGATAGCGGGGTCGGCAAGACGTCGTTAATGAATCAATATGTGCACAAGAAGTTTA GCCAACAATATAAGGCTACGATTGGTGCGGATTTCGTGACTAAAGAACTACAGATTGATGACAGGCTCGTCACTCTGCAAATATGGGACACAGCTGGACA AGAAAGATTTCAGTCGCTTGGAGTTGCATTTTATAGAGGAGCAGATTGCTGTGTTCTAGTCTATGATGTGAATGTCATGAGATCATTTGATACTCTTGAC AACTGGCATGAAGAGTTTCTTAAACAGGCAACCCCGTCTGATCCCAGGACATTTCCATTTATATTACTTGGAAACAAGATAGATATCGATGGTGGAAATA GCCGAGTGGTTTCTGAGAAGAAAGCTAAGGACTGGTGTGCTTCAAAAGGAAACATACCTTACTTTGAGACGTCAGCAAAAGAAGATTACAATGTTGATCC TGCATTCCTGTCCATTGCCAAAATTGCTCTAGCCAATGAGCATGAACAAGACATATACTTCCAGGGTATCCCAGAGGCTGCCTCAGAGAGTGAGCAAAGA GGTGGTTGTGCATGTTAA
AA sequence Show only first row Show all	>Potri.002G062400.1 pacid=42778269 polypeptide=Potri.002G062400.1.p locus=Potri.002G062400 ID=Potri.002G062400.1.v4.1 annot-version=v4.1 MSTRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLD NWHEEFLKQATPSDPRTFPFILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDPAFLSIAKIALANEHEQDIYFQGIPEAASESEQR GGCAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Potri.002G062400 [exp]	0	1	Pt-RAB7.2
AT3G04830			Protein prenylyltransferase su...		Potri.005G051300 [exp]	11.53	0.7924
AT5G67500		VDAC2, ATVDAC2	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.005G146800 [exp]	12.76	0.8402
AT1G66740		AtSP7, SGA2, AS...	ANTI- SILENCING FUNCTION 1A, A...		Potri.017G121100 [exp]	13.07	0.7526	SGA902
AT5G55070			Dihydrolipoamide succinyltrans...		Potri.011G089200 [exp]	14.49	0.8360
AT3G13920		RH4, TIF4A1, EI...	eukaryotic translation initiat...		Potri.006G225700 [exp]	18.49	0.8327	TIF4.1
AT2G40060		CLC2	clathrin light chain 2, Clathr...		Potri.010G190400 [exp]	22.62	0.8319
AT2G14110			Haloacid dehalogenase-like hyd...		Potri.017G043700 [exp]	25.37	0.7718
AT1G30890			Integral membrane HRF1 family ...		Potri.017G028500 [exp]	31.74	0.7881
					Potri.013G057766 [exp]	33.94	0.7379
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.017G010600 [exp]	46.13	0.7891

Compare expression of checked genes

Potri.002G062400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.