Plant FIBer expression Database

Potri.002G063601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09750 54 / 4e-10 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G197700
[exp]
55 / 2e-10 AT4G09750 535 / 0.0 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037921
[exp]
50 / 2e-08 AT3G10540 694 / 0.0 3-phosphoinositide-dependent protein kinase (.1)
PFAM info
Representative CDS sequence
>Potri.002G063601.1 pacid=42778874 polypeptide=Potri.002G063601.1.p locus=Potri.002G063601 ID=Potri.002G063601.1.v4.1 annot-version=v4.1
ATGTGCACAGTCCCCTTGAATACAGATCTACAGTTTAGCAAAGGAAAATTTGAAGGCATAGAACAGTATGCTCGAAACAAGCGAATTCAAGTTTGCAACT
TTTGCATGCTAGAGCTTCATAGATCCTCTCCAGTCATGAATAGCTTGGATGTTGTGATTCTGTGGATATCACCTGTATTCTTGATGCGCATGCTCTTCTT
TGGTAGCTTTTTGATAATTTTTAAATTCGTTTCCAGATTTAGGTTTAGAAATTGA
AA sequence
>Potri.002G063601.1 pacid=42778874 polypeptide=Potri.002G063601.1.p locus=Potri.002G063601 ID=Potri.002G063601.1.v4.1 annot-version=v4.1
MCTVPLNTDLQFSKGKFEGIEQYARNKRIQVCNFCMLELHRSSPVMNSLDVVILWISPVFLMRMLFFGSFLIIFKFVSRFRFRN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G09750 NAD(P)-binding Rossmann-fold s... Potri.002G063601
[exp]
0 1
AT2G43210 Ubiquitin-like superfamily pro... Potri.017G036600
[exp]
3.46 0.7799
AT4G27190 NB-ARC domain-containing disea... Potri.001G446966
[exp]
9.16 0.7832
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Potri.016G000400
[exp]
11.48 0.7782 RAB11.7
Potri.010G046225
[exp]
15.49 0.7252
AT1G69370 CM-3, CM3 chorismate mutase 3 (.1) Potri.010G162300
[exp]
19.44 0.7644
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Potri.008G053601
[exp]
22.36 0.7745
AT1G11120 unknown protein Potri.019G103800
[exp]
27.34 0.7614
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Potri.011G040900
[exp]
27.65 0.6561
AT5G20260 Exostosin family protein (.1) Potri.006G064850
[exp]
27.83 0.7406
Potri.008G084200
[exp]
29.94 0.7428

Potri.002G063601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.