Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09800 152 / 5e-49 RPS18C S18 ribosomal protein (.1) AT1G34030 152 / 5e-49 Ribosomal protein S13/S18 family (.1) AT1G22780 152 / 5e-49 RPS18A, PFL1, PFL 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G211200 [exp] 152 / 5e-49 AT4G09800 276 / 7e-97 S18 ribosomal protein (.1) Potri.002G051300 [exp] 152 / 5e-49 AT4G09800 275 / 2e-96 S18 ribosomal protein (.1) Potri.005G196600 [exp] 150 / 2e-47 AT4G09800 278 / 2e-96 S18 ribosomal protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034179 [exp] 152 / 4e-49 AT1G34030 302 / 3e-107 Ribosomal protein S13/S18 family (.1) Lus10042603 [exp] 151 / 1e-48 AT1G22780 304 / 5e-108 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1) Lus10006914 [exp] 151 / 1e-48 AT4G09800 304 / 5e-108 S18 ribosomal protein (.1) Lus10014676 [exp] 150 / 3e-48 AT1G34030 303 / 1e-107 Ribosomal protein S13/S18 family (.1) Lus10022057 [exp] 150 / 3e-48 AT4G09800 303 / 1e-107 S18 ribosomal protein (.1) Lus10043405 [exp] 149 / 3e-48 AT1G34030 245 / 3e-85 Ribosomal protein S13/S18 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0303 [poplar] [flax] H2TH PF00416 [poplar] [flax] Ribosomal_S13 Ribosomal protein S13/S18
Representative CDS sequence Show only first row Show all	>Potri.002G064632.1 pacid=42779583 polypeptide=Potri.002G064632.1.p locus=Potri.002G064632 ID=Potri.002G064632.1.v4.1 annot-version=v4.1 ATGACTATTGTTGCAAATCCTTGCCAGTTCAAAATCCCAGACTGGTTTTTGAATAGGCAGAAGGATTACACGGATGGGAAGTATTCTCAGGTCGTGTCAA ACGCATTGGACATGAAGTTGAGAGATGATTTGGAGTGTTTGAAGAAGATTCGGAACCACCGTGGTCTGAGGCACTACTGGGGTCTTATTGTCAGGGGTCA GCACACAGACTACTGGCCGCGTGGAAAGACTGTTGGTGTCTCGAAGAAGCGCTGA
AA sequence Show only first row Show all	>Potri.002G064632.1 pacid=42779583 polypeptide=Potri.002G064632.1.p locus=Potri.002G064632 ID=Potri.002G064632.1.v4.1 annot-version=v4.1 MTIVANPCQFKIPDWFLNRQKDYTDGKYSQVVSNALDMKLRDDLECLKKIRNHRGLRHYWGLIVRGQHTDYWPRGKTVGVSKKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.002G064632 [exp]	0	1
AT5G47770		FPS1	farnesyl diphosphate synthase ...		Potri.016G004100 [exp]	1.41	0.7893
AT2G37520			Acyl-CoA N-acyltransferase wit...		Potri.009G016832 [exp]	21.02	0.7140
AT1G14810			semialdehyde dehydrogenase fam...		Potri.010G105000 [exp]	21.16	0.7254
AT5G06450			Polynucleotidyl transferase, r...		Potri.013G049000 [exp]	32.03	0.6911
AT1G16260			Wall-associated kinase family ...		Potri.014G148400 [exp]	78.13	0.6611
AT1G14810			semialdehyde dehydrogenase fam...		Potri.010G105300 [exp]	92.22	0.7029
					Potri.016G004601 [exp]	131.62	0.6887
AT1G64290			F-box protein-related (.1)		Potri.008G038000 [exp]	137.36	0.6524
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Potri.008G071100 [exp]	218.67	0.6402	DREB1,Pt-ABI4.1

Compare expression of checked genes

Potri.002G064632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.