Lil6_1,OHP2.2 (Potri.002G065000) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Lil6_1,OHP2.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34000 154 / 3e-48 OHP2 one-helix protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G196100 202 / 1e-66 AT1G34000 154 / 8e-48 one-helix protein 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017779 147 / 3e-45 AT1G34000 173 / 2e-55 one-helix protein 2 (.1)
Lus10000462 144 / 6e-44 AT1G34000 166 / 9e-53 one-helix protein 2 (.1)
PFAM info
Representative CDS sequence
>Potri.002G065000.1 pacid=42779836 polypeptide=Potri.002G065000.1.p locus=Potri.002G065000 ID=Potri.002G065000.1.v4.1 annot-version=v4.1
ATGTCAGTGGCATCTTCAATCCCATACATCAAAATCCCAAACCCTTCATCGTCATCTTGCTCCTTCCCATCTTCCTCTTCATCAACCTCCTCAACATCTT
CTTTCTGTAGGTTTTCTACAATAACAAGGCCTTATATTGTGACCATAAGAAGCTCTCAAGCTGAAGGGCCTGTAAGGAGACCTGTGGCCCCTCCTCTTAG
AGCACCTTCCTCGCCAGCAGCACCATCGCCTCCCTTGAATCCCGTCCCTCCTCCTTCACCGTCTTCTCCAGTGACTCCACCACCCAAGCCAGCTGCTCAA
GTGGCCGTGAAGGACAAGAATGTGGTTACTTTGGAGTTTCAGAGACAAAAGGCTAAGGAACTTCAAGAATATTTTAAGAAGAAGAAGTTTGAGGAGGCAG
ATCAAGGTCCTTTCTTTGGGTTCGTTGGAAAGAATGAGATTGCTAATGGAAGATGGGCAATGTTTGGTTTTGCTGTTGGAATGCTAACAGAGTATGCAAC
GGGCTCGGACTTTGTTGATCAAGTAAAGATACTTCTGTCCAATTTCGGGATATTAGATCTGGAATAA
AA sequence
>Potri.002G065000.1 pacid=42779836 polypeptide=Potri.002G065000.1.p locus=Potri.002G065000 ID=Potri.002G065000.1.v4.1 annot-version=v4.1
MSVASSIPYIKIPNPSSSSCSFPSSSSSTSSTSSFCRFSTITRPYIVTIRSSQAEGPVRRPVAPPLRAPSSPAAPSPPLNPVPPPSPSSPVTPPPKPAAQ
VAVKDKNVVTLEFQRQKAKELQEYFKKKKFEEADQGPFFGFVGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGILDLE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G34000 OHP2 one-helix protein 2 (.1) Potri.002G065000 0 1 Lil6_1,OHP2.2
AT2G32480 ARASP ARABIDOPSIS SERIN PROTEASE (.1... Potri.014G154000 2.00 0.9816
AT4G28025 unknown protein Potri.006G175600 3.16 0.9686
AT5G07900 Mitochondrial transcription te... Potri.001G035200 4.89 0.9745
AT5G08050 Protein of unknown function (D... Potri.015G058600 6.63 0.9689
AT1G26220 Acyl-CoA N-acyltransferases (N... Potri.008G113600 7.93 0.9724
AT5G52190 Sugar isomerase (SIS) family p... Potri.015G140600 8.06 0.9639
AT5G58260 NdhN NADH dehydrogenase-like comple... Potri.013G160600 8.12 0.9682
AT1G22630 unknown protein Potri.013G108100 9.38 0.9664
AT2G24820 AtTic55, TIC55-... translocon at the inner envelo... Potri.018G015700 9.48 0.9641
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Potri.003G132400 9.53 0.9666

Potri.002G065000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.