Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 84 / 1e-22 Protein of unknown function (DUF3511) (.1) AT5G11970 62 / 6e-14 Protein of unknown function (DUF3511) (.1) AT1G72720 59 / 1e-12 Protein of unknown function (DUF3511) (.1) AT2G19460 56 / 1e-11 Protein of unknown function (DUF3511) (.1) AT2G47480 56 / 1e-11 Protein of unknown function (DUF3511) (.1) AT3G05725 52 / 6e-10 Protein of unknown function (DUF3511) (.1) AT3G62640 51 / 1e-09 Protein of unknown function (DUF3511) (.1) AT3G13910 49 / 8e-09 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G195800 [exp] 144 / 9e-47 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.007G077500 [exp] 82 / 3e-22 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 57 / 4e-12 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 57 / 6e-12 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 57 / 1e-11 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 56 / 3e-11 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 53 / 2e-10 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 48 / 1e-08 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 43 / 6e-07 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033529 [exp] 82 / 4e-22 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10005802 [exp] 79 / 5e-21 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10006799 [exp] 79 / 5e-21 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10020842 [exp] 74 / 2e-18 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 72 / 3e-18 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10028734 [exp] 71 / 8e-18 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10017155 [exp] 63 / 5e-14 AT5G11970 93 / 1e-25 Protein of unknown function (DUF3511) (.1) Lus10021581 [exp] 62 / 1e-13 AT5G11970 97 / 4e-27 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 60 / 9e-13 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 59 / 9e-13 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [poplar] [flax] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Potri.002G065200.2 pacid=42779446 polypeptide=Potri.002G065200.2.p locus=Potri.002G065200 ID=Potri.002G065200.2.v4.1 annot-version=v4.1 ATGGAGAAGAGCAAGTCATTCCCTCAATATTCTTCATTTTTCTCCGGTGAATTTGGGTTTGAAGATCAATCGAATTCATATAACTTTAACGGGCCATGCC AAAAGGGAAATGGTTTTGCAACATCAAGCGATCCAGAGCTGAAAAGGAAGAAGAGGATTGCATCTTACAATGTTTTTACCGTGGAGGGTAAGCTTAAATC TAGTGCAAGGAACAGTTTCAAGTGGATCAAGAGCAAGTTCAGCGACGCTCGGTATGGTATGTGA
AA sequence Show only first row Show all	>Potri.002G065200.2 pacid=42779446 polypeptide=Potri.002G065200.2.p locus=Potri.002G065200 ID=Potri.002G065200.2.v4.1 annot-version=v4.1 MEKSKSFPQYSSFFSGEFGFEDQSNSYNFNGPCQKGNGFATSSDPELKRKKRIASYNVFTVEGKLKSSARNSFKWIKSKFSDARYGM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09890			Protein of unknown function (D...		Potri.002G065200 [exp]	0	1
AT5G63710			Leucine-rich repeat protein ki...		Potri.001G306000 [exp]	1.41	0.8317
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.015G027800 [exp]	3.46	0.8106
AT3G27520			unknown protein		Potri.001G343200 [exp]	4.58	0.7750
AT2G35550	BBR_BPC	BPC7, BBR/BPC7,...	basic pentacysteine 7 (.1.2.3....		Potri.001G133900 [exp]	6.00	0.7870
AT1G03730			unknown protein		Potri.013G130300 [exp]	11.40	0.7570
AT3G24770		CLE41	CLAVATA3/ESR-RELATED 41 (.1)		Potri.012G019400 [exp]	14.83	0.7856
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Potri.004G145500 [exp]	18.70	0.7265	OST1.2
AT1G55790			Domain of unknown function (DU...		Potri.006G002700 [exp]	21.72	0.7733
AT4G20150			unknown protein		Potri.003G156301 [exp]	25.65	0.7554
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Potri.004G057300 [exp]	25.88	0.6924

Compare expression of checked genes

Potri.002G065200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.