Potri.002G066300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G013300 73 / 3e-16 ND /
Potri.008G013400 43 / 4e-05 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.003G086600 40 / 0.0003 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039120 46 / 3e-06 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10038738 45 / 1e-05 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10001658 42 / 0.0001 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.002G066300.1 pacid=42779792 polypeptide=Potri.002G066300.1.p locus=Potri.002G066300 ID=Potri.002G066300.1.v4.1 annot-version=v4.1
ATGGATTCCTCAAGTCACGTCTTCATATTATCAGCCATTTTGATGCTCCTCGTTTCCCAGTCAATGGCAACAGTTGCCCCATCCGAGCTAGTAGAAGATG
TCTGCACTGAGATTGAGAAATTGATGATGGCTTACGGTGAAAGATCAGGGTATGTCGCAAAATATGATGAATGCGTCAATGCTCTTCAAATGGATCCTAG
AACTGCCACAGCAAACATCTCCACTCTTGCCGAAATTAGTGTCCAGTTGGCGATTTCCGGTGCGAAAAATGCCAAGGCTTTGATAGAAAACCTTCTCGGG
AATACAACTCCTTCAAGAGAGCCCCTTCAGAATTGTCTGTCCTCGTACGTGAATATCACTGGCCATTTCGAAAATGCACTCTCGGGGCTAAGTGCAGGTC
TGCAATCTTCCCACTTCGACATCGCGGGGGTTTTGGACCTTGTCAAGATATGTGAACTTGAATTGACAAAGAACCAGACTCATATTCTGCAGCTTACAAA
CAGAAACCACTACACGCGCATGTTTGTTGAAATCTCAGAATTTCTCATAACCCGTCTTGAATTATATCACATAGGCAACGGCTTCACACAGACGAGGACT
CAAGGTTAA
AA sequence
>Potri.002G066300.1 pacid=42779792 polypeptide=Potri.002G066300.1.p locus=Potri.002G066300 ID=Potri.002G066300.1.v4.1 annot-version=v4.1
MDSSSHVFILSAILMLLVSQSMATVAPSELVEDVCTEIEKLMMAYGERSGYVAKYDECVNALQMDPRTATANISTLAEISVQLAISGAKNAKALIENLLG
NTTPSREPLQNCLSSYVNITGHFENALSGLSAGLQSSHFDIAGVLDLVKICELELTKNQTHILQLTNRNHYTRMFVEISEFLITRLELYHIGNGFTQTRT
QG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G066300 0 1
Potri.009G025001 3.46 0.8860
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Potri.006G048300 10.58 0.8483
AT5G25757 RNA polymerase I-associated fa... Potri.018G038500 15.09 0.8827
AT3G27080 TOM20-3 translocase of outer membrane ... Potri.003G173400 15.09 0.8964 Pt-TOM20.2
AT3G55605 Mitochondrial glycoprotein fam... Potri.010G198500 18.02 0.8527
Potri.001G108450 23.91 0.8605
Potri.011G073216 24.24 0.8662
AT3G20000 TOM40 translocase of the outer mitoc... Potri.014G004100 26.60 0.8764
AT1G57720 Translation elongation factor ... Potri.003G004700 27.87 0.8749
AT5G60390 GTP binding Elongation factor ... Potri.008G043100 28.46 0.8639 ADR12.3

Potri.002G066300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.