Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02010 52 / 7e-10 ATROPGEF7, ROPGEF7 RHO guanyl-nucleotide exchange factor 7 (.1) AT5G05940 42 / 2e-06 ATROPGEF5, ROPGEF5 ROP guanine nucleotide exchange factor 5 (.1) AT4G38430 42 / 3e-06 ATROPGEF1, ROPGEF1 rho guanyl-nucleotide exchange factor 1 (.1) AT4G00460 38 / 6e-05 ATROPGEF3, ROPGEF3 RHO guanyl-nucleotide exchange factor 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092600 [exp] 59 / 2e-12 AT5G02010 676 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Potri.016G104400 [exp] 56 / 2e-11 AT5G02010 632 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Potri.008G062000 [exp] 50 / 4e-09 AT5G05940 664 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Potri.010G196000 [exp] 49 / 5e-09 AT5G05940 659 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Potri.004G179742 [exp] 49 / 6e-09 AT4G38430 729 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Potri.009G140100 [exp] 42 / 1e-06 AT4G38430 715 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Potri.002G014100 [exp] 37 / 0.0001 AT4G38430 592 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Potri.005G247100 [exp] 35 / 0.0004 AT4G38430 553 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021500 [exp] 51 / 2e-09 AT5G02010 664 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Lus10022601 [exp] 51 / 2e-09 AT5G02010 662 / 0.0 RHO guanyl-nucleotide exchange factor 7 (.1) Lus10004676 [exp] 50 / 4e-09 AT5G05940 667 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10040248 [exp] 49 / 1e-08 AT5G05940 661 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10000399 [exp] 46 / 9e-08 AT5G05940 630 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10009874 [exp] 45 / 3e-07 AT5G05940 643 / 0.0 ROP guanine nucleotide exchange factor 5 (.1) Lus10023983 [exp] 37 / 0.0001 AT4G38430 696 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1) Lus10025101 [exp] 36 / 0.0003 AT4G38430 683 / 0.0 rho guanyl-nucleotide exchange factor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03759 [poplar] [flax] PRONE PRONE (Plant-specific Rop nucleotide exchanger)
Representative CDS sequence Show only first row Show all	>Potri.002G068366.1 pacid=42777009 polypeptide=Potri.002G068366.1.p locus=Potri.002G068366 ID=Potri.002G068366.1.v4.1 annot-version=v4.1 ATGTTTCTTAAAAATCGATCGTCGTCCCCGCCTTTGTTTCAGCATGGAAAAGCCAGCATAGGAGACCTCATCTATCGATATATTTCTTCAGATCAATTGT ATCCAGAATGTCTCCTTGATTGGCTAGATTTATCTTTCTAA
AA sequence Show only first row Show all	>Potri.002G068366.1 pacid=42777009 polypeptide=Potri.002G068366.1.p locus=Potri.002G068366 ID=Potri.002G068366.1.v4.1 annot-version=v4.1 MFLKNRSSSPPLFQHGKASIGDLIYRYISSDQLYPECLLDWLDLSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02010		ATROPGEF7, ROPG...	RHO guanyl-nucleotide exchange...		Potri.002G068366 [exp]	0	1
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Potri.010G191500 [exp]	24.33	0.6928
AT2G24370			Protein kinase protein with ad...		Potri.011G008356 [exp]	103.66	0.6262
AT3G57790			Pectin lyase-like superfamily ...		Potri.006G057100 [exp]	105.31	0.5655
AT1G66180			Eukaryotic aspartyl protease f...		Potri.017G131800 [exp]	122.13	0.5886
AT5G64220	CAMTA		Calmodulin-binding transcripti...		Potri.008G099733 [exp]	130.02	0.5705
AT3G59850			Pectin lyase-like superfamily ...		Potri.017G004701 [exp]	167.40	0.5671
AT1G26820		RNS3	ribonuclease 3 (.1)		Potri.010G168600 [exp]	190.24	0.5892	S.1

Compare expression of checked genes

Potri.002G068366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.