Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64667 44 / 4e-07 IDL2 inflorescence deficient in abscission (IDA)-like 2 (.1) AT3G18715 43 / 7e-07 IDL4 inflorescence deficient in abscission (IDA)-like 4 (.1) AT1G76952 40 / 1e-05 IDL5 inflorescence deficient in abscission (IDA)-like 5 (.1) AT5G09805 39 / 3e-05 IDL3 inflorescence deficient in abscission (IDA)-like 3 (.1) AT1G68765 36 / 0.0002 IDA INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) AT2G07722 36 / 0.0008 unknown protein ATMG00620 35 / 0.0009 ATMG00620.1, ORF139B unknown protein ATMG00170 35 / 0.0009 ATMG00170.1, ORF139A unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G189900 [exp] 92 / 1e-26 AT5G64667 47 / 1e-08 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.007G110700 [exp] 49 / 2e-09 AT5G64667 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.005G057400 [exp] 46 / 5e-08 AT5G64667 59 / 5e-13 inflorescence deficient in abscission (IDA)-like 2 (.1) Potri.013G074000 [exp] 40 / 6e-06 AT1G68765 43 / 7e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.008G114600 [exp] 39 / 3e-05 AT1G68765 46 / 5e-08 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Potri.010G131500 [exp] 39 / 3e-05 AT1G68765 49 / 3e-09 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005811 [exp] 40 / 1e-05 AT5G64667 63 / 2e-14 inflorescence deficient in abscission (IDA)-like 2 (.1) Lus10020848 [exp] 38 / 5e-05 AT3G18715 53 / 1e-10 inflorescence deficient in abscission (IDA)-like 4 (.1) Lus10034385 [exp] 38 / 6e-05 AT1G68765 44 / 5e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10034260 [exp] 38 / 8e-05 AT1G68765 44 / 6e-07 INFLORESCENCE DEFICIENT IN ABSCISSION, Putative membrane lipoprotein (.1) Lus10033523 [exp] 37 / 0.0001 AT3G18715 51 / 8e-10 inflorescence deficient in abscission (IDA)-like 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G070401.1 pacid=42780228 polypeptide=Potri.002G070401.1.p locus=Potri.002G070401 ID=Potri.002G070401.1.v4.1 annot-version=v4.1 ATGGGTAGGAGTCATCTGGTTCTAGTTCTATGGTTACTCTTGCTCGCACCATTTGTTAGTCATACTTGTGGCTCGAGGCAGACTAAGATTTTCAAGATGA TTGAGCCCAGTTCTCAGAATTCTTCACCGGGTACTTTTTCGGGGTTCTTCCCAAAGGGAATGCCGATCCCCCCATCTGGTCCTTCGAAGAAGCACAATGA CATCGGTTTACGAAGTTCCGAGCCATTGCCATGA
AA sequence Show only first row Show all	>Potri.002G070401.1 pacid=42780228 polypeptide=Potri.002G070401.1.p locus=Potri.002G070401 ID=Potri.002G070401.1.v4.1 annot-version=v4.1 MGRSHLVLVLWLLLLAPFVSHTCGSRQTKIFKMIEPSSQNSSPGTFSGFFPKGMPIPPSGPSKKHNDIGLRSSEPLP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64667		IDL2	inflorescence deficient in abs...		Potri.002G070401 [exp]	0	1
AT5G53950	NAC	ATCUC2, CUC2, A...	CUP-SHAPED COTYLEDON 2, Arabid...		Potri.001G396300 [exp]	1.00	0.9340
					Potri.004G142600 [exp]	14.28	0.8100
AT5G37630		EMB2656	EMBRYO DEFECTIVE 2656, ARM rep...		Potri.004G085500 [exp]	17.60	0.7385
AT4G02070		ATMSH6, MSH6-1	MUTS HOMOLOG 6-1, ARABIDOPSIS...		Potri.008G191051 [exp]	19.23	0.7775
					Potri.015G116300 [exp]	19.59	0.7841
					Potri.010G199150 [exp]	23.87	0.8245
AT2G31955		CNX2	cofactor of nitrate reductase ...		Potri.001G230604 [exp]	29.51	0.7360
AT3G42960		ASD, ATA1	TAPETUM1, TAPETUM 1 (.1)		Potri.008G141800 [exp]	31.04	0.5930	Pt-ATA1.1
					Potri.008G024601 [exp]	31.63	0.8193
					Potri.006G216950 [exp]	34.81	0.8185

Compare expression of checked genes

Potri.002G070401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.