Potri.002G070600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21326 75 / 3e-16 VQ motif-containing protein (.1)
AT1G21320 69 / 1e-13 nucleotide binding;nucleic acid binding (.1.2)
AT3G18690 57 / 7e-10 MKS1 MAP kinase substrate 1 (.1)
AT1G68450 54 / 6e-09 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT3G18360 48 / 1e-06 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G189300 229 / 5e-76 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
Potri.005G057800 70 / 2e-14 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Potri.007G110100 67 / 2e-13 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
Potri.015G046600 56 / 2e-09 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1)
Potri.012G055900 54 / 1e-08 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.006G199300 48 / 2e-07 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.010G123700 48 / 2e-06 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029768 108 / 4e-29 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10042794 90 / 2e-22 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1)
Lus10028604 56 / 2e-09 ND /
Lus10009033 56 / 4e-09 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10018905 47 / 6e-07 ND /
Lus10012286 41 / 3e-05 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
Lus10037918 41 / 0.0001 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.002G070600.2 pacid=42776729 polypeptide=Potri.002G070600.2.p locus=Potri.002G070600 ID=Potri.002G070600.2.v4.1 annot-version=v4.1
ATGGATTCATCAGACTTCCCTATCAGTAGATCACCAAGAAAAGAATTGCAAGGTCCTAGACCACCAGCTTTGAAAATCCGCAAAGATTCACACAAGATCA
GAAAACCACCAGTAGCACCGCAACCATTCCAACAGCAACCACAGAATCAACCACCAACACAGCAACGCCCTCCCGTGATAATCTATACAGTGTCACCTAA
GGTGATTCATACAAACCCTAATGACTTCATGACCCTAGTTCAACGTCTCACAGGCTCCTCATCAACATCAACCTCCTCCAATCCCTTTAATGATGATTGT
GGTGCAATATCGCCTGCAGCAAGGTTTGCTACAATTGAGAAGGCCAACTCACCCAAAGATCAGCAAAAGCAGCAGCAGCTAGGCGGAGATTTGGGTTATG
TTGAAGGGATCATGGAGATTGATCGAGTAATGGAGAGACCAAGTTTGGGTCCTGGAATTCTGTCTCCTGGGCCAGCTTCACTTCCTCCAATACCACCAAA
CTTCTTCTCTCCTGATCAAAACTCGGTTAGCTTCTTCCATGATTTGAGTCCTATTCTTCATGGTAACAGGAATTTTATTGAGGGTAGTTTCATGCCTAGT
CCTTCAACCTTTGTTTGGCCACGCATAAATTCTCCAAGCACTCCATCTACAGACCTTTTCAATAATTTCAATGCTTACAATAATTTATTTGACTTTTGA
AA sequence
>Potri.002G070600.2 pacid=42776729 polypeptide=Potri.002G070600.2.p locus=Potri.002G070600 ID=Potri.002G070600.2.v4.1 annot-version=v4.1
MDSSDFPISRSPRKELQGPRPPALKIRKDSHKIRKPPVAPQPFQQQPQNQPPTQQRPPVIIYTVSPKVIHTNPNDFMTLVQRLTGSSSTSTSSNPFNDDC
GAISPAARFATIEKANSPKDQQKQQQLGGDLGYVEGIMEIDRVMERPSLGPGILSPGPASLPPIPPNFFSPDQNSVSFFHDLSPILHGNRNFIEGSFMPS
PSTFVWPRINSPSTPSTDLFNNFNAYNNLFDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G21326 VQ motif-containing protein (.... Potri.002G070600 0 1
AT3G05220 Heavy metal transport/detoxifi... Potri.005G120200 5.19 0.9318
AT2G45220 Plant invertase/pectin methyle... Potri.015G127700 10.00 0.9196 Pt-PME.5
AT5G06720 ATPA2 peroxidase 2 (.1) Potri.016G058200 10.95 0.9070 HPOX14.2
AT4G17490 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element bi... Potri.003G080600 14.69 0.9034
AT5G66420 unknown protein Potri.005G120100 15.87 0.9177
AT1G17860 Kunitz family trypsin and prot... Potri.017G153466 19.28 0.8848
AT3G10720 Plant invertase/pectin methyle... Potri.008G011100 19.59 0.9057
AT4G35220 Cyclase family protein (.1) Potri.001G301700 20.39 0.9036
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.001G134400 20.66 0.9045
AT3G58000 VQ motif-containing protein (.... Potri.016G046000 21.16 0.8971

Potri.002G070600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.