Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21210 71 / 1e-15 WAK4 wall associated kinase 4 (.1) AT1G21270 68 / 9e-15 WAK2 wall-associated kinase 2 (.1) AT1G21240 67 / 3e-14 WAK3 wall associated kinase 3 (.1) AT1G21250 67 / 4e-14 PRO25, WAK1 cell wall-associated kinase (.1) AT1G21230 62 / 1e-12 WAK5 wall associated kinase 5 (.1) AT1G21245 60 / 2e-12 Protein kinase superfamily protein (.1) AT3G25490 54 / 1e-09 Protein kinase family protein (.1) AT1G79680 51 / 8e-09 ATWAKL10 WALL ASSOCIATED KINASE (WAK)-LIKE 10 (.1) AT1G16130 48 / 1e-07 WAKL2 wall associated kinase-like 2 (.1) AT1G16150 48 / 2e-07 WAKL4 wall associated kinase-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G075901 [exp] 167 / 5e-51 AT1G21270 507 / 5e-174 wall-associated kinase 2 (.1) Potri.002G076000 [exp] 169 / 2e-50 AT1G21270 631 / 0.0 wall-associated kinase 2 (.1) Potri.009G154600 [exp] 50 / 3e-08 AT1G21270 447 / 2e-147 wall-associated kinase 2 (.1) Potri.004G192400 [exp] 50 / 3e-08 AT1G21270 466 / 2e-154 wall-associated kinase 2 (.1) Potri.004G192900 [exp] 49 / 8e-08 AT1G21270 458 / 1e-151 wall-associated kinase 2 (.1) Potri.009G154100 [exp] 47 / 2e-07 AT1G21270 437 / 2e-143 wall-associated kinase 2 (.1) Potri.001G038300 [exp] 46 / 4e-07 AT1G16260 621 / 0.0 Wall-associated kinase family protein (.1.2) Potri.003G185800 [exp] 46 / 6e-07 AT1G16260 530 / 7e-180 Wall-associated kinase family protein (.1.2) Potri.001G038525 [exp] 46 / 7e-07 AT1G16260 642 / 0.0 Wall-associated kinase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008105 [exp] 49 / 6e-08 AT1G16120 419 / 3e-137 wall associated kinase-like 1 (.1) Lus10013143 [exp] 47 / 2e-07 AT1G16160 270 / 2e-85 wall associated kinase-like 5 (.1) Lus10004504 [exp] 47 / 3e-07 AT1G16130 411 / 5e-134 wall associated kinase-like 2 (.1) Lus10038077 [exp] 47 / 5e-07 AT1G21270 576 / 0.0 wall-associated kinase 2 (.1) Lus10000764 [exp] 38 / 0.0005 AT3G59420 1255 / 0.0 crinkly4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G076051.1 pacid=42777498 polypeptide=Potri.002G076051.1.p locus=Potri.002G076051 ID=Potri.002G076051.1.v4.1 annot-version=v4.1 ATGGTGAAGCAGGATAATATTAGGCAGCTGAAGGGAGTTGCCAACATTGCAAAGAAGTGCTTAAGAGTAAAAGGAGAGGGAAGACCCAACATGAAGAATG TAGCAATGGAATTAGAGGGGCTAAGAACATCTGCAAAACATCCTTGGACTAATGACGAATCAAATGTAGAAGAGACAGAGTACTTGCTTGGTAAATCAGT GGAAACTGCTCGTTTTGAGGAAATGGCTGGTACAAGTGCTGGATATCACAGTTTACAGAATTATTTAATGCAATCACTGGATGGTGGCAGATGA
AA sequence Show only first row Show all	>Potri.002G076051.1 pacid=42777498 polypeptide=Potri.002G076051.1.p locus=Potri.002G076051 ID=Potri.002G076051.1.v4.1 annot-version=v4.1 MVKQDNIRQLKGVANIAKKCLRVKGEGRPNMKNVAMELEGLRTSAKHPWTNDESNVEETEYLLGKSVETARFEEMAGTSAGYHSLQNYLMQSLDGGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Potri.002G076051 [exp]	0	1
AT3G50740		UGT72E1	UDP-glucosyl transferase 72E1 ...		Potri.007G029800 [exp]	28.56	0.7653
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Potri.004G120600 [exp]	45.44	0.7815
AT5G22300		AtNIT4, NIT4	nitrilase 4 (.1)		Potri.016G074200 [exp]	45.49	0.7700
AT5G55860			Plant protein of unknown funct...		Potri.016G005200 [exp]	52.82	0.7615
AT2G44710			RNA-binding (RRM/RBD/RNP motif...		Potri.015G130701 [exp]	62.03	0.7636
AT5G54280		ATMYOS1, ATM4, ...	ARABIDOPSIS THALIANA MYOSIN 1,...		Potri.011G126800 [exp]	98.71	0.7381
AT1G06530		PMD2	peroxisomal and mitochondrial ...		Potri.002G060200 [exp]	115.72	0.7327
AT3G62270			HCO3- transporter family (.1)		Potri.008G100300 [exp]	115.99	0.6966
AT1G28580			GDSL-like Lipase/Acylhydrolase...		Potri.011G064100 [exp]	130.65	0.7058
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Potri.007G138800 [exp]	133.48	0.6831

Compare expression of checked genes

Potri.002G076051 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.