Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77230 226 / 2e-75 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G17970 51 / 2e-07 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT4G08320 49 / 7e-07 TPR8 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G04240 45 / 1e-05 SEC secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G65160 45 / 2e-05 TPR14 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) AT1G04190 44 / 3e-05 TPR3 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G14950 42 / 0.0001 TTL2 tetratricopetide-repeat thioredoxin-like 2 (.1) AT2G42580 42 / 0.0001 VIT, TTL3 VHI-INTERACTING TPR CONTAINING PROTEIN, tetratricopetide-repeat thioredoxin-like 3 (.1) AT4G30480 42 / 0.0001 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT1G56090 42 / 0.0001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G184001 [exp] 50 / 5e-08 AT1G77230 0 / 1 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G392601 [exp] 51 / 2e-07 AT1G53300 260 / 1e-79 tetratricopetide-repeat thioredoxin-like 1 (.1) Potri.006G178900 [exp] 50 / 2e-07 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.016G075700 [exp] 50 / 3e-07 AT3G11540 1505 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.006G208900 [exp] 50 / 4e-07 AT3G11540 1506 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G177400 [exp] 49 / 6e-07 AT4G08320 406 / 1e-139 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G100700 [exp] 49 / 8e-07 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.011G111500 [exp] 49 / 1e-06 AT1G53300 707 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Potri.019G025600 [exp] 46 / 7e-06 AT3G04240 1689 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029734 [exp] 118 / 4e-31 AT3G25140 213 / 8e-72 QUASIMODO 1, GALACTURONOSYLTRANSFERASE 8, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10035117 [exp] 49 / 5e-07 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10009682 [exp] 49 / 6e-07 AT3G17970 700 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10042001 [exp] 48 / 2e-06 AT3G17970 714 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10017009 [exp] 48 / 2e-06 AT3G11540 1356 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10021336 [exp] 47 / 4e-06 AT3G11540 1509 / 0.0 SPINDLY, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10041189 [exp] 47 / 5e-06 AT1G04190 516 / 0.0 tetratricopeptide repeat 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003113 [exp] 47 / 6e-06 AT3G04240 1687 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004779 [exp] 46 / 8e-06 AT3G04240 1683 / 0.0 secret agent, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032234 [exp] 45 / 1e-05 AT1G62740 892 / 0.0 Hop2, stress-inducible protein, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF00515 [poplar] [flax] TPR_1 Tetratricopeptide repeat CL0020 [poplar] [flax] TPR PF13414 [poplar] [flax] TPR_11 TPR repeat
Representative CDS sequence Show only first row Show all	>Potri.002G076700.2 pacid=42778704 polypeptide=Potri.002G076700.2.p locus=Potri.002G076700 ID=Potri.002G076700.2.v4.1 annot-version=v4.1 ATGAAAGTAACATGGAAGAAGGAGAGCAAGAAGCGACCTTTAGCAGCCATATCAAAGTACCCAAACCTCCCTTTTGATCAACAAGATATGATCCACAACG ACGACGAAGACAATAATAGCCATACCAAGCAACTGGGTGCCTCTCACAAGTCCTTGGATTCAGAAGCATCCAATAGACAACTCGCCGACTCTTTCCAAGA CCTAGGCAACAAGCTAGCCGAGGATGGAAAATATCGTGAGGCACTTGGGAAATGGGAGGCTGCTCTTAATTTGATGCCTGGAAATGCAGTCTTACATGAG CAAAAGGCACAGGTTTTGCTTGAAATTGGAGATCCCTGGAGTGCATTGAAGGCAGCAACTCGAGCAACTGAGTTGGAATCGTCATGGGCGGAGGCATGGA TCACCCTTGGCAGAGCACAGTTGAACTTTGGGGAGCCTGACAGCGCAATTGAAAGCTTTGATAAAGCATTAGCCATTAAGCCTGATTCTAAGGAAGCTCA AGGTGACAGACACGGTGCATTACAGCTTGTAAAGAAGCGAAAGCAGCTTCATTCATCAGGTTTGAGTAGTAAAGAGAACCGTTATGTGGTCAGTGACAAG ACTGAGAGCTCCTGA
AA sequence Show only first row Show all	>Potri.002G076700.2 pacid=42778704 polypeptide=Potri.002G076700.2.p locus=Potri.002G076700 ID=Potri.002G076700.2.v4.1 annot-version=v4.1 MKVTWKKESKKRPLAAISKYPNLPFDQQDMIHNDDEDNNSHTKQLGASHKSLDSEASNRQLADSFQDLGNKLAEDGKYREALGKWEAALNLMPGNAVLHE QKAQVLLEIGDPWSALKAATRATELESSWAEAWITLGRAQLNFGEPDSAIESFDKALAIKPDSKEAQGDRHGALQLVKKRKQLHSSGLSSKENRYVVSDK TESS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.002G076700 [exp]	0	1
AT3G29280			unknown protein		Potri.017G090400 [exp]	1.41	0.8463
AT1G48320			Thioesterase superfamily prote...		Potri.010G003800 [exp]	6.48	0.7277
AT4G14385			unknown protein		Potri.002G038700 [exp]	6.48	0.7831
AT5G10980			Histone superfamily protein (....		Potri.005G072300 [exp]	8.94	0.7772
AT5G19430			RING/U-box superfamily protein...		Potri.001G275900 [exp]	9.79	0.7594
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Potri.001G122700 [exp]	13.07	0.7774
AT4G04830		ATMSRB5	methionine sulfoxide reductase...		Potri.008G198600 [exp]	15.42	0.7410	PtrMsrB3
AT2G16365			F-box family protein (.1.2.3.4...		Potri.009G118651 [exp]	16.97	0.7379
AT3G43740			Leucine-rich repeat (LRR) fami...		Potri.009G090700 [exp]	17.54	0.7533
AT5G53850			haloacid dehalogenase-like hyd...		Potri.001G399000 [exp]	18.33	0.7676

Compare expression of checked genes

Potri.002G076700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.