Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21550 122 / 3e-36 Calcium-binding EF-hand family protein (.1) AT4G20780 107 / 1e-29 CML42 calmodulin like 42 (.1) AT1G05990 98 / 2e-26 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT2G43290 98 / 8e-26 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT3G59440 96 / 4e-25 Calcium-binding EF-hand family protein (.1) AT4G03290 95 / 4e-25 EF hand calcium-binding protein family (.1) AT3G07490 90 / 2e-23 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT4G12860 90 / 3e-23 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1) AT5G44460 88 / 2e-22 CML43 calmodulin like 43 (.1) AT1G24620 78 / 2e-18 EF hand calcium-binding protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G183300 [exp] 265 / 3e-92 AT1G21550 136 / 1e-41 Calcium-binding EF-hand family protein (.1) Potri.007G128600 [exp] 110 / 7e-31 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.017G029700 [exp] 110 / 1e-30 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.006G112500 [exp] 99 / 1e-26 AT4G20780 238 / 2e-80 calmodulin like 42 (.1) Potri.016G142000 [exp] 94 / 3e-24 AT4G20780 197 / 3e-64 calmodulin like 42 (.1) Potri.002G239100 [exp] 91 / 7e-24 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.006G065900 [exp] 87 / 3e-21 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.018G127100 [exp] 78 / 4e-18 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.012G048200 [exp] 75 / 2e-17 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000972 [exp] 163 / 5e-52 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10028657 [exp] 155 / 2e-48 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10042762 [exp] 119 / 2e-31 AT1G77260 741 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10003239 [exp] 100 / 5e-27 AT4G20780 249 / 5e-85 calmodulin like 42 (.1) Lus10021134 [exp] 100 / 1e-26 AT4G20780 236 / 8e-80 calmodulin like 42 (.1) Lus10009564 [exp] 96 / 1e-25 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10017174 [exp] 97 / 2e-25 AT4G20780 234 / 4e-79 calmodulin like 42 (.1) Lus10035611 [exp] 95 / 1e-24 AT4G20780 242 / 3e-82 calmodulin like 42 (.1) Lus10029730 [exp] 90 / 6e-24 AT1G21550 68 / 8e-16 Calcium-binding EF-hand family protein (.1) Lus10042761 [exp] 90 / 2e-23 AT1G21550 70 / 7e-16 Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.002G077300.1 pacid=42778176 polypeptide=Potri.002G077300.1.p locus=Potri.002G077300 ID=Potri.002G077300.1.v4.1 annot-version=v4.1 ATGTGTCCTCTTAAAACAAATGACCTGCACCGGATTTTCCATGAACTTGACAAAAATGGTGATGGTCTTTTGAGTACAGTGGAGCTCAATTGGCTTCTCG AGAGCATCGGAGTCCATTTTAGCCTAGAGGAGCTTGAGTCTTCGGTGGGGAAGTCATGCCTCAGCTTTGACGAGTTCTCGTTATTTTACGACTCCATAAC AAAGCAGAGCGATGATCCCAGCAACAAAGCAGTGCTAGCAGACGATGAGGAAGGCCGCAACAAGGAGGAATGTGACCTTTTTGAGGCATTTAAGGTGTTT GATTCTAATGGAGACGGATTCATTTCTTGCGAGGAGCTTCAAAGTTTGTTGTCAAAACTTGGATTGTGGGATGAGAAGACTGGTAAGGATTGTAGGAGTA TGCTTTGCCGATATGATACGAACCTGGATGGGGTTGTTGATTTTGAAGAATTCAAGAAAATGATGCTGCGTACCAGTTTGTAA
AA sequence Show only first row Show all	>Potri.002G077300.1 pacid=42778176 polypeptide=Potri.002G077300.1.p locus=Potri.002G077300 ID=Potri.002G077300.1.v4.1 annot-version=v4.1 MCPLKTNDLHRIFHELDKNGDGLLSTVELNWLLESIGVHFSLEELESSVGKSCLSFDEFSLFYDSITKQSDDPSNKAVLADDEEGRNKEECDLFEAFKVF DSNGDGFISCEELQSLLSKLGLWDEKTGKDCRSMLCRYDTNLDGVVDFEEFKKMMLRTSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G21550			Calcium-binding EF-hand family...		Potri.002G077300 [exp]	0	1
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003251 [exp]	1.41	0.9951
AT4G11480		CRK32	cysteine-rich RLK (RECEPTOR-li...		Potri.017G005500 [exp]	3.74	0.9938
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G003800 [exp]	4.47	0.9948
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.017G004400 [exp]	5.47	0.9949
					Potri.017G003866 [exp]	6.70	0.9925
AT1G68040			S-adenosyl-L-methionine-depend...		Potri.019G016102 [exp]	8.94	0.9891
AT4G12410			SAUR-like auxin-responsive pro...		Potri.001G119900 [exp]	9.11	0.9715
AT1G16130		WAKL2	wall associated kinase-like 2 ...		Potri.004G192300 [exp]	9.27	0.9828
AT1G28710			Nucleotide-diphospho-sugar tra...		Potri.012G112600 [exp]	10.09	0.9899
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Potri.006G046100 [exp]	10.39	0.9940

Compare expression of checked genes

Potri.002G077300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.