Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ACO1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77330 455 / 1e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G62380 311 / 8e-106 ATACO2, ACO2 ACC oxidase 2 (.1) AT1G12010 305 / 2e-103 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G05010 297 / 4e-100 ACO4, EAT1, EFE ethylene forming enzyme, ethylene-forming enzyme (.1) AT2G19590 256 / 3e-84 ATACO1, ACO1 ACC oxidase 1 (.1) AT5G24530 208 / 3e-65 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 197 / 1e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 193 / 4e-59 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 189 / 3e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G05600 188 / 3e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G182700 [exp] 597 / 0 AT1G77330 461 / 4e-165 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G159000 [exp] 330 / 2e-113 AT1G05010 464 / 8e-166 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.002G224100 [exp] 328 / 1e-112 AT1G05010 440 / 2e-156 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.004G003000 [exp] 327 / 6e-112 AT1G05010 467 / 6e-167 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.011G020900 [exp] 323 / 1e-110 AT1G05010 473 / 1e-169 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.006G151600 [exp] 275 / 1e-91 AT2G19590 462 / 2e-165 ACC oxidase 1 (.1) Potri.006G101100 [exp] 206 / 4e-64 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 206 / 4e-64 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 203 / 3e-63 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000857 [exp] 488 / 2e-175 AT1G77330 440 / 2e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028678 [exp] 488 / 3e-175 AT1G77330 435 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10029992 [exp] 313 / 2e-106 AT1G05010 496 / 2e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10035334 [exp] 313 / 2e-106 AT1G05010 495 / 6e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10015153 [exp] 305 / 2e-103 AT1G05010 501 / 1e-180 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10031530 [exp] 305 / 3e-103 AT1G05010 498 / 3e-179 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10008564 [exp] 271 / 6e-90 AT2G19590 423 / 6e-150 ACC oxidase 1 (.1) Lus10030185 [exp] 193 / 3e-59 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 188 / 7e-57 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10015573 [exp] 187 / 7e-57 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.002G078600.1 pacid=42779048 polypeptide=Potri.002G078600.1.p locus=Potri.002G078600 ID=Potri.002G078600.1.v4.1 annot-version=v4.1 ATGGCAATTCCAGTGATTGATTTCTCTAAGGTAAATGGCACCGGTGAAGAGAGGGCCAAGACAATGGCTCAGATTGCCAATGGATGCGAGGAGTGGGGAT TCTTCCAGCTGATGAACCATGGAATTCCAGAGGAGCTCCTAGAGAAAGTGAAGAAGGTTTGCTCTGAATATTTTAAACTGGAAAGAGAGGAAATTTTCAA GAACTCAACGGTAGCAAACACTTTGAATGCTTTAGCTGAGAAGAATAGCGGTGAGAAATTGGAGAATGTGGACTGGGAAGATGTCATCACTCTCCTTGAT GATAACGAGTGGCCATCAAAAACCTCTGGATTCAAGGAAACCATGACTGAATATCGTGCTGAGCTCAAGAAATTGGCTGAGAAGGTCATGGAAGTGATGG ATGAGAACTTGAGCTTGCCAAAAGGATACATCAAGAAAGCATTCAATGATGGAGAAGGACACAGTGCCTTCTTTGGTACCAAGGTTAGCCACTACCCACC ATGTCCTCATCCTGAGCTAGTCAATGGCCTCCGAGCCCACACCGATGCTGGGGGTGTCATCTTACTCTTCCAAGATGATGTGGTAGGCGGCCTTCAAATC CTCAAAGATGGGCAATGGATTGATGTCCAGCCAATGAAGAACACTATTGTCATCAATACTGGCGATCAGATTGAGGTCCTTAGCAATGGTCGATACAAGA GTACCTGGCACCGTGTTTTGGCCACCCCAGACGGGAACAGAAGATCGATTGCTTCGTTCTATAATCCATCACTTAAGGCCACCATTGCCCCTGCACCAGG ATTGGTGGAAAAAGATGACGAAGAGATCAATCAAACTTACCCCAAGTTTTTGTTCGGTGATTACATGTCTGTTTATGCTAAGCAGAAGTTCCTTCCTAAA GAGCCAAGGTTCGAAGCTGTAAGGGCCTTGTAA
AA sequence Show only first row Show all	>Potri.002G078600.1 pacid=42779048 polypeptide=Potri.002G078600.1.p locus=Potri.002G078600 ID=Potri.002G078600.1.v4.1 annot-version=v4.1 MAIPVIDFSKVNGTGEERAKTMAQIANGCEEWGFFQLMNHGIPEELLEKVKKVCSEYFKLEREEIFKNSTVANTLNALAEKNSGEKLENVDWEDVITLLD DNEWPSKTSGFKETMTEYRAELKKLAEKVMEVMDENLSLPKGYIKKAFNDGEGHSAFFGTKVSHYPPCPHPELVNGLRAHTDAGGVILLFQDDVVGGLQI LKDGQWIDVQPMKNTIVINTGDQIEVLSNGRYKSTWHRVLATPDGNRRSIASFYNPSLKATIAPAPGLVEKDDEEINQTYPKFLFGDYMSVYAKQKFLPK EPRFEAVRAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.002G078600 [exp]	0	1	ACO1
AT3G15620		UVR3	UV REPAIR DEFECTIVE 3, DNA pho...		Potri.003G060000 [exp]	3.46	0.9431
AT1G32930			Galactosyltransferase family p...		Potri.001G450200 [exp]	3.60	0.9395
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Potri.004G210600 [exp]	3.74	0.9588
AT1G17200			Uncharacterised protein family...		Potri.011G140200 [exp]	4.00	0.9553
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Potri.006G160700 [exp]	4.24	0.9537
AT4G27730		ATOPT6	ARABIDOPSIS THALIANA OLIGOPEPT...		Potri.012G019500 [exp]	5.00	0.9538
AT4G32285			ENTH/ANTH/VHS superfamily prot...		Potri.006G066900 [exp]	5.19	0.9487
AT1G54520			unknown protein		Potri.008G152400 [exp]	5.38	0.9102
AT5G19580			glyoxal oxidase-related protei...		Potri.006G160800 [exp]	6.00	0.9350
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.005G182700 [exp]	6.40	0.8952	ACO4

Compare expression of checked genes

Potri.002G078600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.