Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24590 177 / 2e-55 PLSP1 plastidic type i signal peptidase 1 (.1) AT2G30440 159 / 1e-47 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1) AT1G06870 158 / 4e-47 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G23465 57 / 3e-10 Peptidase S24/S26A/S26B/S26C family protein (.1) AT3G08980 52 / 2e-08 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G29960 51 / 5e-08 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G53530 49 / 3e-07 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G081800 [exp] 177 / 5e-55 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1) Potri.006G157900 [exp] 176 / 2e-54 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1) Potri.014G036400 [exp] 176 / 4e-54 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.016G115100 [exp] 52 / 2e-08 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.001G380400 [exp] 50 / 7e-08 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.005G092900 [exp] 47 / 1e-06 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.007G071400 [exp] 39 / 0.0006 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023651 [exp] 170 / 1e-52 AT3G24590 318 / 2e-109 plastidic type i signal peptidase 1 (.1) Lus10034925 [exp] 168 / 6e-52 AT3G24590 316 / 1e-108 plastidic type i signal peptidase 1 (.1) Lus10032753 [exp] 174 / 2e-50 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10011671 [exp] 121 / 1e-35 AT2G30440 172 / 7e-54 plastidic type I signal peptidase 2B, thylakoid processing peptide (.1) Lus10002492 [exp] 54 / 3e-09 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10005571 [exp] 54 / 5e-09 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10013703 [exp] 54 / 2e-08 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2) Lus10004822 [exp] 52 / 2e-08 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10025393 [exp] 49 / 3e-07 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0299 [poplar] [flax] Peptidase_SF PF00717 [poplar] [flax] Peptidase_S24 Peptidase S24-like
Representative CDS sequence Show only first row Show all	>Potri.002G079600.1 pacid=42777072 polypeptide=Potri.002G079600.1.p locus=Potri.002G079600 ID=Potri.002G079600.1.v4.1 annot-version=v4.1 ATGAGTTTCTTGAGGCCATCTGCATTGAATAATTTCTTTATAACATCCGCCACAGTACTAAAATGGATGCCATGCCAGAGCTGGGGGTTTCTTCGATGGC CTGGTCTTGATGGGTTGTTAAGGCTTCTTGTTCTGGTGCTTTTGTGGTCTACTTTTTCAGAGCTTCGCTTCATCCCGTCGTCCTCCATGTACCCGACTCT TCGTGTTGGCGATCGTATCATCATTGAAAAGGCCTCATACTATCTCAAGGTACCGGCTATAAATGATATAGTTACATTCCGAGCTCCGAAACAGCTCGGA ATCACAGGGGAAGATGTTTTCATAAAGAGAGTTGTTGCAAAGGCAGGAGACTTGGTTCAGGTTCACCATGGATCACTTTATGTCAATGGAATTGCCCAAA CCGAAGACTTCCTAGTCGAGCAACCTGCATATACATCTAATTTAACTTATGTGCCTGAAGGTCATGTTTATGTGCTGGGTGATAACCGTAATAACAGCTA CGACTCCCATGTTTGGGGACCCCTTCCTATAAAGAACGTTATTGGAAGATTTGTAACGTGTTGCTACAGGCCTTCAAACAAATGA
AA sequence Show only first row Show all	>Potri.002G079600.1 pacid=42777072 polypeptide=Potri.002G079600.1.p locus=Potri.002G079600 ID=Potri.002G079600.1.v4.1 annot-version=v4.1 MSFLRPSALNNFFITSATVLKWMPCQSWGFLRWPGLDGLLRLLVLVLLWSTFSELRFIPSSSMYPTLRVGDRIIIEKASYYLKVPAINDIVTFRAPKQLG ITGEDVFIKRVVAKAGDLVQVHHGSLYVNGIAQTEDFLVEQPAYTSNLTYVPEGHVYVLGDNRNNSYDSHVWGPLPIKNVIGRFVTCCYRPSNK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24590		PLSP1	plastidic type i signal peptid...		Potri.002G079600 [exp]	0	1
AT4G14950		KMS1	Killing Me Slowly 1, SNARE ass...		Potri.013G021700 [exp]	2.44	0.6755
AT5G04040		SDP1	SUGAR-DEPENDENT1, Patatin-like...		Potri.016G041000 [exp]	3.74	0.7149
AT5G65740			zinc ion binding (.1.2.3.4)		Potri.007G008300 [exp]	16.49	0.6806
AT1G70590			F-box family protein (.1)		Potri.008G187200 [exp]	27.74	0.6301
AT3G63530		BB2, BB	BIG BROTHER, RING/U-box superf...		Potri.001G019600 [exp]	30.19	0.6275
AT1G28510			Optic atrophy 3 protein (OPA3)...		Potri.011G059800 [exp]	35.22	0.6129
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Potri.012G043000 [exp]	38.67	0.6362	Pt-SKOR.2
AT3G14067			Subtilase family protein (.1)		Potri.001G167300 [exp]	40.49	0.5798
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Potri.007G018000 [exp]	50.59	0.6152	Pt-TRXH.1,PtrTrxh4
AT3G18060			transducin family protein / WD...		Potri.012G049200 [exp]	55.27	0.5540

Compare expression of checked genes

Potri.002G079600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.