Pt-PBC2.2 (Potri.002G080800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PBC2.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21720 383 / 1e-137 PBC1 proteasome beta subunit C1 (.1)
AT1G77440 380 / 1e-136 PBC2 20S proteasome beta subunit C2 (.1.2)
AT3G60820 89 / 6e-22 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G180500 410 / 2e-148 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1)
Potri.002G148300 88 / 2e-21 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 87 / 4e-21 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020599 352 / 1e-125 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1)
Lus10004885 352 / 1e-125 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1)
Lus10015867 97 / 1e-24 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 79 / 7e-17 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10000062 47 / 7e-07 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Potri.002G080800.1 pacid=42777740 polypeptide=Potri.002G080800.1.p locus=Potri.002G080800 ID=Potri.002G080800.1.v4.1 annot-version=v4.1
ATGTCGATATTCGAGTACAATGGAAGTGCCATAGTAGCTATGGTAGGCAAGAACTGCTTCGCTATAGCTAGCGACCGACGACTTGGAGTAAACCTTCAAA
CAGTCGCTACTGATTTCCAGCGAATCTACAAAATCCACGATAAGCTCTTTGTCGGTCTCTCTGGCCTTGGCACTGACGCCCAAACTCTGTATCAGAGGCT
TGTTTTCCGTCACAAATTGTATCAGCTGCGAGAAGAAAGGGACATGAAGCCTGAGACTTTTGCTAACCTTGTTTCTGCTGTACTTTATGAGAAAAGGTTC
GGTCCGTATTTCTGCCAACCTGTTATTGCTGGATTGGATGATGATGACAAGCCATTCATTTGCACAATGGATTTCATTGGGGCCAAGGAACTTGCAAAAG
ATTTTGTTGTTGCTGGCTCAGCCTCTGAGTCCCTTTATGGTGCCTGCGAAGCATTTTTCAAGCCTGACATGGAACCTGATGAATTATTTGAAGTTGTATC
CCAAGCGTTGCTAGCATCAGTAGATCGGGACTGCTTGAGTGGTTGGGGAGGACACATCTATATTGTGACCCCTGATGATATTAAAGAGAAAATCCTAAAG
GGAAGGATGGATTGA
AA sequence
>Potri.002G080800.1 pacid=42777740 polypeptide=Potri.002G080800.1.p locus=Potri.002G080800 ID=Potri.002G080800.1.v4.1 annot-version=v4.1
MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKLFVGLSGLGTDAQTLYQRLVFRHKLYQLREERDMKPETFANLVSAVLYEKRF
GPYFCQPVIAGLDDDDKPFICTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPDMEPDELFEVVSQALLASVDRDCLSGWGGHIYIVTPDDIKEKILK
GRMD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Potri.002G080800 0 1 Pt-PBC2.2
AT1G14320 RPL10A, RPL10, ... SUPPRESSOR OF ACAULIS 52, ribo... Potri.013G159301 14.10 0.8258
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Potri.012G129300 14.17 0.8127
Potri.008G084001 15.49 0.7860
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.018G030900 23.32 0.7749
AT5G66680 DGL1 DEFECTIVE GLYCOSYLATION, dolic... Potri.004G157900 26.38 0.7936
AT1G23230 unknown protein Potri.010G108350 34.29 0.7936
AT2G39990 AteIF3f, EIF2 Arabidopsis thaliana eukaryoti... Potri.008G065500 34.77 0.7585
Potri.011G073216 35.07 0.7986
AT5G61240 Leucine-rich repeat (LRR) fami... Potri.008G093400 38.52 0.7376
Potri.013G160350 39.49 0.7626

Potri.002G080800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.