Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25310 48 / 3e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 47 / 7e-07 ATSRG1, SRG1 senescence-related gene 1 (.1) AT5G20550 44 / 7e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 43 / 1e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 43 / 1e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 43 / 1e-05 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 42 / 2e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G07480 42 / 3e-05 KUOX1 KAR-UP oxidoreductase 1 (.1) AT3G60290 42 / 3e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G44090 41 / 7e-05 GA2OX5, ATGA20OX5 ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 5, gibberellin 20-oxidase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G086700 [exp] 48 / 2e-07 AT5G08640 432 / 9e-153 flavonol synthase 1 (.1.2) Potri.019G014454 [exp] 47 / 6e-07 AT5G08640 454 / 1e-161 flavonol synthase 1 (.1.2) Potri.004G139600 [exp] 46 / 1e-06 AT5G08640 470 / 7e-168 flavonol synthase 1 (.1.2) Potri.001G381700 [exp] 46 / 1e-06 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.012G006300 [exp] 45 / 2e-06 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 45 / 2e-06 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.009G025900 [exp] 45 / 3e-06 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G355200 [exp] 44 / 4e-06 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1) Potri.018G121800 [exp] 44 / 7e-06 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025619 [exp] 64 / 4e-13 AT5G08640 349 / 5e-120 flavonol synthase 1 (.1.2) Lus10028068 [exp] 50 / 7e-08 AT5G08640 429 / 1e-151 flavonol synthase 1 (.1.2) Lus10025620 [exp] 49 / 8e-08 AT5G08640 424 / 2e-149 flavonol synthase 1 (.1.2) Lus10011985 [exp] 49 / 2e-07 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1) Lus10009238 [exp] 48 / 2e-07 AT1G06640 250 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10022292 [exp] 48 / 3e-07 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10011987 [exp] 48 / 3e-07 AT1G78550 284 / 1e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032574 [exp] 47 / 9e-07 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10015573 [exp] 46 / 1e-06 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10042493 [exp] 45 / 2e-06 AT1G17020 242 / 4e-80 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.002G086550.1 pacid=42780091 polypeptide=Potri.002G086550.1.p locus=Potri.002G086550 ID=Potri.002G086550.1.v4.1 annot-version=v4.1 ATGGCCCCTCCATTAATTCCAGAAATTATAGCTCCCCTGCATGCCAATATTGTTTATTCACAGAAGAAAATAAAAGAGGAAATTGAGAATTGCAGACGAG GTATTGAAGTTGCTGTCAAAAGGACTGGAAATATGTATCCTCCATGCGCACAACCTGAACCAGCCCTGGAAGTTGAACCTCATATTGACATGTCTTCCCT CACCATACTGTCCCAAATGAAGTTCCAGGCCTTCAGGCATGGATGGAAAGATGGCAATTGGATCGCTGTCAAATACCTGCTGATGCACTCTTGGTCGATT CCAAACGAGCAAGGCATCGGGGCATCCTCTTTAGGCATGATGTATCGATTAATATCCCCCGTCATTTAG
AA sequence Show only first row Show all	>Potri.002G086550.1 pacid=42780091 polypeptide=Potri.002G086550.1.p locus=Potri.002G086550 ID=Potri.002G086550.1.v4.1 annot-version=v4.1 MAPPLIPEIIAPLHANIVYSQKKIKEEIENCRRGIEVAVKRTGNMYPPCAQPEPALEVEPHIDMSSLTILSQMKFQAFRHGWKDGNWIAVKYLLMHSWSI PNEQGIGASSLGMMYRLISPVI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25310			2-oxoglutarate (2OG) and Fe(II...		Potri.002G086550 [exp]	0	1
AT4G14615			unknown protein		Potri.008G160101 [exp]	2.44	0.8101
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.005G007750 [exp]	8.12	0.7481
AT4G24280		CPHSC70-1	chloroplast heat shock protein...		Potri.004G224400 [exp]	11.22	0.7947	Pt-HSC70.1
					Potri.009G062700 [exp]	14.28	0.7193
AT4G24280		CPHSC70-1	chloroplast heat shock protein...		Potri.003G006300 [exp]	16.49	0.8052	HSC70.2
AT2G28000		Cpn60alpha1, SL...	SCHLEPPERLESS, chaperonin-60al...		Potri.004G213400 [exp]	16.73	0.7415	SLP.2
AT4G02980		ABP1	endoplasmic reticulum auxin bi...		Potri.002G212400 [exp]	17.20	0.7359
AT2G25620		AtDBP1	DNA-binding protein phosphatas...		Potri.018G115100 [exp]	18.16	0.7110
AT5G54940			Translation initiation factor ...		Potri.010G151700 [exp]	19.20	0.6713
AT1G32460			unknown protein		Potri.003G089100 [exp]	19.36	0.6948

Compare expression of checked genes

Potri.002G086550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.