Potri.002G088500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24620 99 / 2e-26 EF hand calcium-binding protein family (.1)
AT1G66400 87 / 3e-22 CML23 calmodulin like 23 (.1)
AT1G18210 86 / 2e-21 Calcium-binding EF-hand family protein (.1.2)
AT5G37780 84 / 3e-21 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3)
AT1G66410 84 / 3e-21 ACAM-4, CAM4 calmodulin 4 (.1.2)
AT5G21274 83 / 1e-20 ACAM-6, CAM6 calmodulin 6 (.1)
AT3G43810 82 / 2e-20 CAM7 calmodulin 7 (.1)
AT2G41110 82 / 2e-20 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2)
AT2G27030 82 / 2e-20 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3)
AT3G56800 82 / 2e-20 ACAM-3, CAM3 calmodulin 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G107100 109 / 2e-30 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1)
Potri.008G134300 101 / 3e-27 AT1G24620 219 / 2e-73 EF hand calcium-binding protein family (.1)
Potri.015G032600 86 / 6e-22 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3)
Potri.012G041000 86 / 6e-22 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3)
Potri.016G024700 82 / 2e-20 AT3G43810 300 / 2e-106 calmodulin 7 (.1)
Potri.009G021500 82 / 2e-20 AT3G43810 300 / 2e-106 calmodulin 7 (.1)
Potri.006G026700 82 / 2e-20 AT3G43810 300 / 2e-106 calmodulin 7 (.1)
Potri.001G222200 83 / 3e-20 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3)
Potri.012G048200 80 / 3e-19 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007816 164 / 2e-52 AT1G24620 69 / 7e-15 EF hand calcium-binding protein family (.1)
Lus10028913 94 / 6e-25 AT1G24620 204 / 5e-68 EF hand calcium-binding protein family (.1)
Lus10004330 94 / 7e-25 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1)
Lus10018012 92 / 5e-24 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2)
Lus10027283 82 / 3e-20 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Lus10038981 82 / 3e-20 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Lus10037423 82 / 3e-20 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Lus10041288 82 / 3e-20 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Lus10038088 84 / 4e-20 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10006644 84 / 7e-20 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0220 EF_hand PF13499 EF-hand_7 EF-hand domain pair
CL0220 EF_hand PF13833 EF-hand_8 EF-hand domain pair
Representative CDS sequence
>Potri.002G088500.1 pacid=42778434 polypeptide=Potri.002G088500.1.p locus=Potri.002G088500 ID=Potri.002G088500.1.v4.1 annot-version=v4.1
ATGGCACAGCTTGGATCCCTTTCTGCTGAATTAGAGTCACTGAACCAAGTCCTGAGCCTGATGGAGGCGTTTAGAGCCTTCGATTCAGACAATGATGGCT
TTATTACAGCTGCTGAGCTTGGCGGCATCTTGGGGTCACTTGGATACAACGCAAGTGAACAAGATGTGAGTGCAATGATGCAGCAAGGAGACACTAACAA
GGATGGTTTGCTAAGCATGCAAGAGTTTTTGGAGATGAACACCAAGGATATGGAGCTCGGTGAACTTGCAAACTTGCTCCAAACTGCCTTTGATGCTCTT
GATGTTGATGTTGATGGTATTGTTACTGCAGAGGAATTGTACGAGGCTACAGTGAATGGCGGGTTAGATTTGTCTTTGGAGGATTGCCAAGGCATTATTG
CTTCCATAGATGCAGATGGTGATGGAGCTGTTAGCTGCAATGACTTCAAGCTGATTGTTAATTCCCTTCAGATCCTAGAAAATTCATTTCTGATGTAG
AA sequence
>Potri.002G088500.1 pacid=42778434 polypeptide=Potri.002G088500.1.p locus=Potri.002G088500 ID=Potri.002G088500.1.v4.1 annot-version=v4.1
MAQLGSLSAELESLNQVLSLMEAFRAFDSDNDGFITAAELGGILGSLGYNASEQDVSAMMQQGDTNKDGLLSMQEFLEMNTKDMELGELANLLQTAFDAL
DVDVDGIVTAEELYEATVNGGLDLSLEDCQGIIASIDADGDGAVSCNDFKLIVNSLQILENSFLM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24620 EF hand calcium-binding protei... Potri.002G088500 0 1
AT1G73040 Mannose-binding lectin superfa... Potri.012G140001 2.00 0.9069
AT1G70880 Polyketide cyclase/dehydrase a... Potri.004G020000 2.44 0.9054
AT4G25970 PSD3, PSD2 phosphatidylserine decarboxyla... Potri.002G127000 3.46 0.9084
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.015G120200 10.00 0.8853
AT5G50920 CLPC1, CLPC, AT... HEAT SHOCK PROTEIN 93-V, DE-RE... Potri.015G105100 12.04 0.9112 Pt-CLPC.2
AT4G13250 NYC1, NYC NON-YELLOW COLORING 1, NAD(P)-... Potri.018G081200 17.02 0.9057
AT3G06980 DEA(D/H)-box RNA helicase fami... Potri.010G004700 23.15 0.9086
AT2G38970 Zinc finger (C3HC4-type RING f... Potri.001G082150 26.32 0.8976
Potri.014G030700 28.46 0.8783
AT5G56350 Pyruvate kinase family protein... Potri.013G060400 28.56 0.8761

Potri.002G088500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.