Potri.002G088800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G088800.2 pacid=42779684 polypeptide=Potri.002G088800.2.p locus=Potri.002G088800 ID=Potri.002G088800.2.v4.1 annot-version=v4.1
ATGAACACAGCAATCCTCAGATTCCCTGCTCTGAAGATTCAGCATCACAGAGCGAACAGCTTGGATTGCTATTTTGTTATTGTCTGTTGTGGAGAAAATA
AATTCCTGATGTCAACTTGTTCAACATTGCAAGTATTTGCCTCCGTTTATATTTTCTCGGGGAGGGTTGTAACTTGTTATTCTGTGAGAGCAATTGCTGT
GAGAATAGGGAAGGGTGCAGTCTTTGTACATATCATCATTATTGTAGCAAATGTGAGTATCATTTTAGTTTTGCCTTTGTTGGTTTTTCTGTGCATATTA
TATCCAAAAAACAATGATTTGCTTGAATATCCTCTTAAGCTAAGGTTTTCTCCACAATAA
AA sequence
>Potri.002G088800.2 pacid=42779684 polypeptide=Potri.002G088800.2.p locus=Potri.002G088800 ID=Potri.002G088800.2.v4.1 annot-version=v4.1
MNTAILRFPALKIQHHRANSLDCYFVIVCCGENKFLMSTCSTLQVFASVYIFSGRVVTCYSVRAIAVRIGKGAVFVHIIIIVANVSIILVLPLLVFLCIL
YPKNNDLLEYPLKLRFSPQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G088800 0 1
AT5G05460 AtENGase85A Endo-beta-N-acetyglucosaminida... Potri.008G072901 3.46 0.9390
AT1G13245 RTFL17, DVL4 DEVIL 4, ROTUNDIFOLIA like 17 ... Potri.010G129600 5.00 0.9550
AT1G49950 MYB ATTRB1, TRB1 telomere repeat binding factor... Potri.009G087000 6.24 0.9041 SMH901
AT1G44760 Adenine nucleotide alpha hydro... Potri.002G084600 7.93 0.9505
AT3G27460 AtSGF29a SaGa associated Factor 29 a, S... Potri.001G342700 9.16 0.9025
Potri.005G124601 9.27 0.9020
Potri.006G225133 9.79 0.9122
Potri.004G169000 10.00 0.9250
AT4G26240 unknown protein Potri.006G153800 11.61 0.9012
AT5G14710 unknown protein Potri.001G349500 12.48 0.9191

Potri.002G088800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.