Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18520 107 / 5e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G03880 77 / 3e-17 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G50420 75 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G23330 69 / 1e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21065 69 / 2e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G56690 69 / 2e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G08070 68 / 3e-14 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G16835 67 / 6e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G32430 67 / 9e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22690 66 / 1e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G170300 [exp] 180 / 1e-54 AT4G18520 717 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G208000 [exp] 82 / 5e-19 AT2G03880 939 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G104700 [exp] 75 / 1e-16 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G096400 [exp] 71 / 3e-15 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G005400 [exp] 71 / 4e-15 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G085800 [exp] 70 / 6e-15 AT4G02750 491 / 3e-164 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G048800 [exp] 70 / 7e-15 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G006400 [exp] 70 / 7e-15 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G067500 [exp] 70 / 9e-15 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029482 [exp] 131 / 1e-36 AT4G18520 624 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039594 [exp] 129 / 1e-35 AT4G18520 619 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002054 [exp] 78 / 1e-17 AT1G74600 930 / 0.0 organelle transcript processing 87, pentatricopeptide (PPR) repeat-containing protein (.1) Lus10024220 [exp] 77 / 3e-17 AT1G74600 924 / 0.0 organelle transcript processing 87, pentatricopeptide (PPR) repeat-containing protein (.1) Lus10001617 [exp] 75 / 1e-16 AT2G03880 840 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022974 [exp] 75 / 2e-16 AT2G03880 542 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017446 [exp] 72 / 2e-15 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10038187 [exp] 71 / 4e-15 AT3G25060 630 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008637 [exp] 70 / 7e-15 AT5G03800 902 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019213 [exp] 67 / 6e-14 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Potri.002G091101.1 pacid=42779444 polypeptide=Potri.002G091101.1.p locus=Potri.002G091101 ID=Potri.002G091101.1.v4.1 annot-version=v4.1 ATGGGTACTTTTTTAGATGATGAAGCTTTAGGGCTGTTTAGGGAGGCCATAAGGGATGGGGTTGTACCAAATAGCAAGGCTTTTGTTTTTGTATTGAATT TGTGTAGTGGAAGATTAGATTTTGAGTTAGGAAGACAAGTCCATGCTCGGGTTGTAAAGGGTGATTGGAGGAATTTGATCGCGGATGGTGCCATTGTTTA TTTATATGTTCAATGTGGTGATTTGAAGAGTGCATTTGGTGTGTTTGATCGGATGGTGGAGCAGGATGTGGTTTCTTGGACAACAAATTTTACTACATCT GGCGCTTCAAAGGCATTTGGAGAGGAGAAGGCATTGAAGTTTGAGAGACAGATGCACGGGTATAGCGAAGAAGATATACCAAGATGA
AA sequence Show only first row Show all	>Potri.002G091101.1 pacid=42779444 polypeptide=Potri.002G091101.1.p locus=Potri.002G091101 ID=Potri.002G091101.1.v4.1 annot-version=v4.1 MGTFLDDEALGLFREAIRDGVVPNSKAFVFVLNLCSGRLDFELGRQVHARVVKGDWRNLIADGAIVYLYVQCGDLKSAFGVFDRMVEQDVVSWTTNFTTS GASKAFGEEKALKFERQMHGYSEEDIPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G18520			Pentatricopeptide repeat (PPR)...		Potri.002G091101 [exp]	0	1
AT4G16835			Tetratricopeptide repeat (TPR)...		Potri.003G081700 [exp]	3.16	0.9391
AT3G18020			Pentatricopeptide repeat (PPR)...		Potri.015G039300 [exp]	3.46	0.9429
AT5G13270		RARE1	REQUIRED FOR ACCD RNA EDITING ...		Potri.003G163701 [exp]	4.89	0.9098
AT5G62370			Tetratricopeptide repeat (TPR)...		Potri.004G200900 [exp]	8.00	0.9198
AT5G07900			Mitochondrial transcription te...		Potri.001G034500 [exp]	8.06	0.9096
AT2G21090			Pentatricopeptide repeat (PPR-...		Potri.004G171801 [exp]	10.00	0.8929
AT2G33680			Tetratricopeptide repeat (TPR)...		Potri.013G006800 [exp]	10.09	0.8857
AT3G62470			Pentatricopeptide repeat (PPR)...		Potri.014G121400 [exp]	10.58	0.9082
AT3G04750			Tetratricopeptide repeat (TPR)...		Potri.005G053600 [exp]	13.85	0.8735
AT5G07900			Mitochondrial transcription te...		Potri.001G029400 [exp]	15.32	0.8758

Compare expression of checked genes

Potri.002G091101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.