Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22050 124 / 5e-38 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1) AT1G77870 113 / 1e-33 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1) AT5G15460 111 / 7e-33 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2) AT3G01050 110 / 1e-32 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1) AT3G26980 105 / 1e-30 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1) AT4G24990 99 / 7e-28 ATGP4 Ubiquitin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G090700 [exp] 121 / 1e-36 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.001G325900 [exp] 116 / 6e-35 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.004G124600 [exp] 113 / 2e-33 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1) Potri.017G068100 [exp] 103 / 8e-30 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Potri.012G103100 [exp] 96 / 1e-26 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1) Potri.015G101200 [exp] 89 / 6e-24 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030704 [exp] 120 / 1e-36 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10013190 [exp] 120 / 3e-36 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2) Lus10041539 [exp] 105 / 2e-30 AT3G26980 168 / 4e-55 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10032014 [exp] 102 / 3e-29 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10035184 [exp] 101 / 6e-29 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1) Lus10012555 [exp] 106 / 1e-27 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF13881 [poplar] [flax] Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Potri.002G091800.1 pacid=42779500 polypeptide=Potri.002G091800.1.p locus=Potri.002G091800 ID=Potri.002G091800.1.v4.1 annot-version=v4.1 ATGGCAACACCAGCTTCGATTGAGCTCAGATTCAGGCTACCAGATGGCAATGATATTGGGCCAAACAACTACACTGAAGCTGCCAATGTGGCGACTCTTA AAGAGCATGTAATTGAGCAATGGCCAAAAGACAAGGAAAATGGCCCGAAGACTATAAAAGATGTGAAGCTTATATATGCTGGACATGTGCTGGAAAACCA TAGAACACTTGCCGAGTCCAGACTTCCTGTCGGTGATCGTCTCGCAGGTGTAGTCACCATACATGTTGTTCTGCGTCCTCCTGGTACACGTATAAACAAT GGTGATCAGCGCATTGATGTTGAATGGCGGGAGGGTTGCTCATGCTCAATCTTGTAG
AA sequence Show only first row Show all	>Potri.002G091800.1 pacid=42779500 polypeptide=Potri.002G091800.1.p locus=Potri.002G091800 ID=Potri.002G091800.1.v4.1 annot-version=v4.1 MATPASIELRFRLPDGNDIGPNNYTEAANVATLKEHVIEQWPKDKENGPKTIKDVKLIYAGHVLENHRTLAESRLPVGDRLAGVVTIHVVLRPPGTRINN GDQRIDVEWREGCSCSIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22050		MUB6	membrane-anchored ubiquitin-fo...		Potri.002G091800 [exp]	0	1
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Potri.006G010500 [exp]	11.13	0.7957	Pt-GDI1.1
AT3G20015			Eukaryotic aspartyl protease f...		Potri.005G063000 [exp]	32.49	0.7187
AT1G16630			unknown protein		Potri.001G190601 [exp]	44.49	0.6670
AT1G80940			unknown protein		Potri.001G041900 [exp]	71.95	0.6280
AT5G43900		XI-6, XI-2, ATM...	MYOSIN XI-6, MYOSIN X1 2, ARAB...		Potri.008G174500 [exp]	115.15	0.6472
AT1G73340			Cytochrome P450 superfamily pr...		Potri.017G154600 [exp]	149.93	0.6610
AT1G75150			unknown protein		Potri.002G262800 [exp]	163.86	0.6508

Compare expression of checked genes

Potri.002G091800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.