Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64080 84 / 3e-20 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 80 / 4e-19 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 71 / 7e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 60 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G36150 61 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 58 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 58 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G14815 54 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 51 / 5e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G169000 [exp] 187 / 4e-60 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 88 / 1e-21 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 87 / 4e-21 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 61 / 1e-11 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 60 / 2e-11 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 49 / 2e-07 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 47 / 2e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 47 / 2e-06 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 47 / 2e-06 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021604 [exp] 79 / 4e-18 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 65 / 5e-13 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 64 / 1e-12 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 60 / 4e-11 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 59 / 5e-11 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 58 / 2e-10 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001153 [exp] 51 / 1e-07 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10042611 [exp] 50 / 1e-07 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10026768 [exp] 49 / 3e-07 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 49 / 8e-07 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.002G092800.2 pacid=42778102 polypeptide=Potri.002G092800.2.p locus=Potri.002G092800 ID=Potri.002G092800.2.v4.1 annot-version=v4.1 ATGAAGACAGCTCTCTTCATTACATGCATTTTGGCCACGCTGGCTGTGCTAGCAAACAGTGCGCAAAATGGATCACCTCCAAAATCACCAGCACCGGCAC CATCAGTAGATTGCAGCGATGTTGCAGTTGACATGTTGGATTGTGTAACCTATTTGTCAGATGGCAATGCGGAGAAGCCCACTGATTCTTGCTGTGCTGG GTTTGAAGCAGTGCTTAGTCTGGATGATGAGTGCTTATGTTTTGCATTAAAGCATAGTGCAGATTTTGGCGTTGCAGTGAATCTTACTAGGGCTGCAGCT TTATCTTCTGAGTGTGGAGTGTCTGCTCCTCCTCTGAGTAGATGTGGCATCTCCGTGCCTCCTTCCGGTGCACCTGCTAACACTCCATCCTCTGCACCAG AGCCAGCTGCACCATCTCCTGTTATAGAGCCACCAACAAATGACCAACCTTCAGCCCCAGCTCCAGCGCCATCGAACAGTGATGATAATGGGAGATCAGC AGCAGCTCCAGTAACTAGTGATGTACCAGCACAAGCACCAGCAAAAGGGAAGGCATGTGCTGTCTCTGCACCCTCTTTGGTTCTTATTAGCTCCGCTGTT GCTTCCGCTCTTTCTCTCTTTCTGTGGATTTGA
AA sequence Show only first row Show all	>Potri.002G092800.2 pacid=42778102 polypeptide=Potri.002G092800.2.p locus=Potri.002G092800 ID=Potri.002G092800.2.v4.1 annot-version=v4.1 MKTALFITCILATLAVLANSAQNGSPPKSPAPAPSVDCSDVAVDMLDCVTYLSDGNAEKPTDSCCAGFEAVLSLDDECLCFALKHSADFGVAVNLTRAAA LSSECGVSAPPLSRCGISVPPSGAPANTPSSAPEPAAPSPVIEPPTNDQPSAPAPAPSNSDDNGRSAAAPVTSDVPAQAPAKGKACAVSAPSLVLISSAV ASALSLFLWI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64080		AtXYP1	xylogen protein 1, Bifunctiona...		Potri.002G092800 [exp]	0	1
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.004G043600 [exp]	4.00	0.7994
AT5G39400		ATPTEN1	Phosphatase and TENsin homolog...		Potri.017G089700 [exp]	4.24	0.7946
AT5G28780			PIF1 helicase (.1)		Potri.009G007400 [exp]	9.16	0.6624
					Potri.006G047250 [exp]	10.24	0.7104
AT4G29250			HXXXD-type acyl-transferase fa...		Potri.018G032700 [exp]	12.24	0.6827
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Potri.015G135900 [exp]	15.49	0.6320	LBD23.2
AT5G38760			Late embryogenesis abundant pr...		Potri.004G107800 [exp]	18.33	0.6188	Pt-LEA1.4
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Potri.018G098300 [exp]	29.58	0.5893	Pt-ATCHX3.2
AT1G50430		ST7R, PA, LE, 7...	PARVA, LEPIDA, DWARF 5, DELTA5...		Potri.010G253301 [exp]	54.16	0.6367
					Potri.009G135900 [exp]	59.39	0.5484

Compare expression of checked genes

Potri.002G092800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.