Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64200 203 / 9e-65 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) AT5G18810 75 / 4e-16 SCL28, At-SCL28 SC35-like splicing factor 28 (.1) AT3G13570 66 / 1e-12 SCL30A, At-SCL30A SC35-like splicing factor 30A (.1) AT5G06210 64 / 1e-12 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G55310 64 / 3e-12 ATSCL33, SR33, At-SCL33 SC35-like splicing factor 33 (.1.2.3) AT3G10400 64 / 4e-12 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT3G47120 64 / 7e-12 C3HZnF RNA recognition motif (RRM)-containing protein (.1) AT3G46020 61 / 7e-12 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G03580 60 / 1e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13860 59 / 2e-11 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G165400 [exp] 278 / 3e-94 AT5G64200 202 / 2e-63 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Potri.003G023800 [exp] 210 / 5e-68 AT5G64200 207 / 4e-66 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Potri.010G026100 [exp] 75 / 4e-16 AT5G18810 172 / 2e-53 SC35-like splicing factor 28 (.1) Potri.008G196700 [exp] 71 / 1e-14 AT5G18810 168 / 8e-52 SC35-like splicing factor 28 (.1) Potri.006G197000 [exp] 71 / 1e-14 AT1G55310 187 / 8e-59 SC35-like splicing factor 33 (.1.2.3) Potri.010G203200 [exp] 71 / 2e-14 AT3G55460 144 / 1e-41 SC35-like splicing factor 30 (.1) Potri.001G006400 [exp] 71 / 2e-14 AT3G13570 170 / 3e-52 SC35-like splicing factor 30A (.1) Potri.003G218600 [exp] 70 / 2e-14 AT3G13570 177 / 7e-55 SC35-like splicing factor 30A (.1) Potri.012G061600 [exp] 70 / 3e-14 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023802 [exp] 207 / 4e-66 AT5G64200 217 / 1e-68 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Lus10003957 [exp] 205 / 5e-66 AT5G64200 217 / 9e-70 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Lus10029426 [exp] 68 / 5e-13 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10002699 [exp] 66 / 1e-12 AT3G55460 138 / 3e-39 SC35-like splicing factor 30 (.1) Lus10003593 [exp] 66 / 3e-12 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10000953 [exp] 66 / 3e-12 AT2G39670 588 / 0.0 Radical SAM superfamily protein (.1.2) Lus10014802 [exp] 65 / 5e-12 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10035678 [exp] 63 / 1e-11 AT2G35410 231 / 2e-74 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10037265 [exp] 63 / 2e-11 AT2G35410 234 / 1e-75 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043158 [exp] 61 / 2e-11 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.002G095800.2 pacid=42779014 polypeptide=Potri.002G095800.2.p locus=Potri.002G095800 ID=Potri.002G095800.2.v4.1 annot-version=v4.1 ATGTCGCACTTCGGCCGATCTGGTCCTCCAGATATCAGAGACACCTTTTCTCTCCTCGTCCTCAACATCACTTTCCGCACCACCGCCGACGATCTTTTCC CTCTCTTCGACAAGTACGGCAAGGTAGTTGATGTATTTATACCTCGCGATCGAAGGACTGGAGAATCGAGAGGTTTTGCCTTTGTGAGGTATAAATATGC TGATGAGGCACAAAAGGCAGTTGATAGGCTTGATGGGAGAGTTGTGGACGGGAGAGAGATTATGGTGCAATTTGCGAAGTATGGTCCTAATGCGGAGCGA ATTCGGGATGGGAGGATAGTGGAATCAACTTCAAAGATAAAGAGTAGGTCCAGAAGCCGCAGCCCTCGTCCAAAGTATCGGGATGGCTACAGGGACCGGG ACAGGGATTACAGAAGGAGAAGTCGCAGTAGAAGCAGGGATCGATCTGAACAGGACGGGTATCGAGGTAGGGATAAAGATTATCATCGCCGAAGTGTGAG CTGCAGCCCTGATCGCCGCAAAGACCGTGGTAGAGGATATGATGAGGAACGACGCAGTTGGAGCCGGTCTCATGGAAGCCCTAATTCTCCAAGGAGTCCT CCACGCAAGGCTCGTCTCAGGGATGAAAGTCCTAATGGACACAATGATAACAAACACTCTCCTACTTCAAAGAGTATCTCTCCTCATGATGAACCGGTGG ATTCTTGA
AA sequence Show only first row Show all	>Potri.002G095800.2 pacid=42779014 polypeptide=Potri.002G095800.2.p locus=Potri.002G095800 ID=Potri.002G095800.2.v4.1 annot-version=v4.1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDLFPLFDKYGKVVDVFIPRDRRTGESRGFAFVRYKYADEAQKAVDRLDGRVVDGREIMVQFAKYGPNAER IRDGRIVESTSKIKSRSRSRSPRPKYRDGYRDRDRDYRRRSRSRSRDRSEQDGYRGRDKDYHRRSVSCSPDRRKDRGRGYDEERRSWSRSHGSPNSPRSP PRKARLRDESPNGHNDNKHSPTSKSISPHDEPVDS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64200		ATSC35, At-SC35	ARABIDOPSIS THALIANA ORTHOLOG ...		Potri.002G095800 [exp]	0	1
AT1G76010			Alba DNA/RNA-binding protein (...		Potri.002G017600 [exp]	4.47	0.7349
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.012G011345 [exp]	6.70	0.6719
AT2G37500			arginine biosynthesis protein ...		Potri.012G115900 [exp]	9.89	0.6863
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.012G005500 [exp]	15.49	0.6612
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Potri.009G158700 [exp]	16.58	0.7349	Pt-RPL30.2
AT5G15700			DNA/RNA polymerases superfamil...		Potri.017G105801 [exp]	24.00	0.6537
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.012G009800 [exp]	29.69	0.5731
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Potri.002G225700 [exp]	30.62	0.6009
AT3G07500	FAR1_related		Far-red impaired responsive (F...		Potri.007G128900 [exp]	30.65	0.6718
					Potri.002G100700 [exp]	33.22	0.6413

Compare expression of checked genes

Potri.002G095800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.