Plant FIBer expression Database

Potri.002G104450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58122 63 / 4e-16 CPuORF45 conserved peptide upstream open reading frame 45 (.1)
AT3G53402 38 / 4e-06 CPuORF46 conserved peptide upstream open reading frame 46 (.1)
AT5G03190 38 / 5e-06 CPuORF47 conserved peptide upstream open reading frame 47 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G113150
[exp]
63 / 4e-16 AT1G58122 56 / 3e-13 conserved peptide upstream open reading frame 45 (.1)
Potri.017G047750
[exp]
52 / 8e-12 ND /
Potri.016G088850
[exp]
36 / 4e-05 AT5G03190 47 / 2e-09 conserved peptide upstream open reading frame 47 (.1.2.3)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.002G104450.1 pacid=42777459 polypeptide=Potri.002G104450.1.p locus=Potri.002G104450 ID=Potri.002G104450.1.v4.1 annot-version=v4.1
ATGGAGGTGCAGCGGTTAAGGCAGTTGATGTTACTTTGGTCTAGAATACAAAGCACCCGTGTGGCCCTCGTGGGTGGGAATCACACCGCCGCCAGGTTTT
GTACTCGCTAA
AA sequence
>Potri.002G104450.1 pacid=42777459 polypeptide=Potri.002G104450.1.p locus=Potri.002G104450 ID=Potri.002G104450.1.v4.1 annot-version=v4.1
MEVQRLRQLMLLWSRIQSTRVALVGGNHTAARFCTR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G58122 CPuORF45 conserved peptide upstream ope... Potri.002G104450
[exp]
0 1
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133200
[exp]
3.00 0.8970
AT4G20970 bHLH bHLH162 basic helix-loop-helix (bHLH) ... Potri.012G079100
[exp]
3.31 0.9119
AT3G61460 BRH1 brassinosteroid-responsive RIN... Potri.010G133300
[exp]
4.24 0.8728
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Potri.002G150500
[exp]
4.47 0.8740 CYP76.3
Potri.010G133401
[exp]
6.00 0.8962
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Potri.007G021300
[exp]
7.48 0.8092
AT5G57520 C2H2ZnF ATZFP2, ZFP2 zinc finger protein 2 (.1) Potri.006G169800
[exp]
9.48 0.8398
AT4G27290 S-locus lectin protein kinase ... Potri.001G413300
[exp]
12.00 0.7832
AT5G43150 unknown protein Potri.013G037800
[exp]
13.22 0.7647
AT3G48520 CYP94B3 cytochrome P450, family 94, su... Potri.005G220900
[exp]
19.97 0.7918 CYP94.8

Potri.002G104450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.