Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 121 / 5e-35 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 115 / 1e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 104 / 1e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 91 / 2e-23 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 88 / 2e-22 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G17020 79 / 1e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G53990 72 / 4e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 71 / 1e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G11360 69 / 2e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G157100 [exp] 158 / 1e-50 AT1G09740 127 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 117 / 2e-33 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 115 / 1e-32 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.016G064000 [exp] 113 / 8e-32 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.008G121900 [exp] 108 / 3e-30 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 107 / 4e-30 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 106 / 3e-29 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 101 / 1e-27 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G122000 [exp] 97 / 8e-26 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009272 [exp] 281 / 4e-98 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10015896 [exp] 234 / 2e-79 AT1G09740 185 / 3e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 118 / 5e-33 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 113 / 3e-32 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 120 / 1e-31 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10034337 [exp] 107 / 1e-29 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 97 / 2e-25 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10006701 [exp] 91 / 3e-23 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 89 / 2e-22 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025033 [exp] 84 / 3e-20 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.002G104700.3 pacid=42777579 polypeptide=Potri.002G104700.3.p locus=Potri.002G104700 ID=Potri.002G104700.3.v4.1 annot-version=v4.1 ATGAGTGCAAACCTTGGATGCGTGATCGTAGCCGTTGATGGAAGCGAGGAGAGCATGAACGCCTTGAGATATGCCCTCGATAACCTCAAGCTCCGATCTC CTGCTCCCGACTCCACTGAAACCCCTGGCTCCTTCGTCATCCTCCATGTCCAACCACCACCGTCTATCGCTGCTGGCCTTAATCCCGGTGCCATCCCTTT TGGCGGACCCAGTGGTTTGGAGGTGCCTGCGTTCACGGCGGCGATTGAAGCGCATCAGAGGAGGATTACGGAGGCGATTCTAGAACATGCCTTGGAGATT TGCCGTGAAAAGAAAGTGAATGTGAAAACACAAGTGGTGATTGGGGATCCAAAGGAGAAGATATGTGAAGTTGCTGAGAATCTGCCCGCCGATTTGCTTG TGATGGGATGTCGTTCTTTTGGCCCTATTAAAAGGATGTTTCTGGGAAGTGTAAGCAATTACTGCACCAACCAGGCACAATGCCCTGTCATAATAGTCAA GGGAAAGGACCCCTCATCGTGA
AA sequence Show only first row Show all	>Potri.002G104700.3 pacid=42777579 polypeptide=Potri.002G104700.3.p locus=Potri.002G104700 ID=Potri.002G104700.3.v4.1 annot-version=v4.1 MSANLGCVIVAVDGSEESMNALRYALDNLKLRSPAPDSTETPGSFVILHVQPPPSIAAGLNPGAIPFGGPSGLEVPAFTAAIEAHQRRITEAILEHALEI CREKKVNVKTQVVIGDPKEKICEVAENLPADLLVMGCRSFGPIKRMFLGSVSNYCTNQAQCPVIIVKGKDPSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09740			Adenine nucleotide alpha hydro...		Potri.002G104700 [exp]	0	1
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Potri.011G101250 [exp]	3.46	0.6964
AT3G54170		ATFIP37	FKBP12 interacting protein 37 ...		Potri.002G197600 [exp]	4.24	0.5883	ATFIP37.1
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Potri.011G099701 [exp]	5.09	0.6809
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Potri.014G069600 [exp]	8.83	0.6219
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041501 [exp]	32.03	0.5412
AT1G08460		HDA8, HDA08, AT...	histone deacetylase 8 (.1)		Potri.009G020500 [exp]	32.49	0.5543
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041650 [exp]	36.49	0.5301
AT2G33390			unknown protein		Potri.008G170700 [exp]	40.98	0.5198
AT2G30330		BLOS1	BLOC subunit 1, GCN5L1 family ...		Potri.013G156700 [exp]	45.38	0.5572
AT2G24170			Endomembrane protein 70 protei...		Potri.006G184200 [exp]	53.24	0.4633

Compare expression of checked genes

Potri.002G104700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.