Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24550 300 / 6e-102 Clathrin adaptor complexes medium subunit family protein (.1.2.3) AT5G46630 100 / 5e-25 Clathrin adaptor complexes medium subunit family protein (.1.2) AT1G10730 76 / 1e-16 Clathrin adaptor complexes medium subunit family protein (.1) AT1G60780 75 / 3e-16 HAP13 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G105100 [exp] 342 / 1e-118 AT4G24550 817 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2.3) Potri.003G090800 [exp] 96 / 1e-23 AT5G46630 831 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2) Potri.001G143800 [exp] 94 / 4e-23 AT5G46630 816 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2) Potri.008G187600 [exp] 86 / 6e-20 AT1G60780 831 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Potri.010G044700 [exp] 79 / 1e-17 AT1G60780 834 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024548 [exp] 306 / 4e-104 AT4G24550 804 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2.3) Lus10003537 [exp] 303 / 2e-102 AT4G24550 785 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2.3) Lus10030961 [exp] 98 / 2e-24 AT5G46630 837 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2) Lus10040086 [exp] 98 / 2e-24 AT5G46630 853 / 0.0 Clathrin adaptor complexes medium subunit family protein (.1.2) Lus10026688 [exp] 81 / 3e-18 AT1G60780 813 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Lus10004626 [exp] 80 / 6e-18 AT1G60780 827 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Lus10042083 [exp] 72 / 5e-15 AT1G60780 779 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Lus10018088 [exp] 72 / 7e-15 AT1G60780 632 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0448 [poplar] [flax] Cargo_bd_muHD PF00928 [poplar] [flax] Adap_comp_sub Adaptor complexes medium subunit family
Representative CDS sequence Show only first row Show all	>Potri.002G105050.1 pacid=42777150 polypeptide=Potri.002G105050.1.p locus=Potri.002G105050 ID=Potri.002G105050.1.v4.1 annot-version=v4.1 ATGAATTATCGGATGACTCAGGAATTTAAACCTCCTTTTCGCATTAATACTTTGATAGAAGAAGCAGGTGCACTTAAGGCTGAAGTGATTCTTAAAGTAT CTGCTGAATTTCCCTCAAGCATTACCGCAAACACAATCATTGTACAGATGCCACTGCCAAAATATACCACCAGAGTTAATTTTGAGTTGGAACCTGGAGC ACTTGGGCAAACAACAGATTTCAAGGAAGCAAATAGGAGGCTTGAATGGGGATTAAAGAAGATTGTTGGGGGATCAGAGCATACCTTACGTGCAAAGCTG ACATTTTCACAGGAGTTGCATGGGAATATCACAAAGGAAGCTGGACCAGTTAGCATGACATTCACAATTCCGATGTATAATGCTTCACGTCTTCAGGTGA AATACTTGCAGATAGCAAAGAAATCAAGTACATATAATCCATATCGATGGGTGAGATACGTTACACAGGCCAATTCCTATGTTGCCCGTATATGA
AA sequence Show only first row Show all	>Potri.002G105050.1 pacid=42777150 polypeptide=Potri.002G105050.1.p locus=Potri.002G105050 ID=Potri.002G105050.1.v4.1 annot-version=v4.1 MNYRMTQEFKPPFRINTLIEEAGALKAEVILKVSAEFPSSITANTIIVQMPLPKYTTRVNFELEPGALGQTTDFKEANRRLEWGLKKIVGGSEHTLRAKL TFSQELHGNITKEAGPVSMTFTIPMYNASRLQVKYLQIAKKSSTYNPYRWVRYVTQANSYVARI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G24550			Clathrin adaptor complexes med...		Potri.002G105050 [exp]	0	1
AT5G58030			Transport protein particle (TR...		Potri.018G110000 [exp]	5.74	0.8904
AT5G11640			Thioredoxin superfamily protei...		Potri.006G237600 [exp]	10.95	0.9044
AT1G43890		ATRAB-C1, RAB18...	RAB GTPASE HOMOLOG 18-1, ARABI...		Potri.005G063500 [exp]	14.96	0.8832	RAB1.8
AT1G65930		cICDH	cytosolic NADP+-dependent isoc...		Potri.004G074900 [exp]	17.17	0.8977
AT2G28760		UXS6	UDP-XYL synthase 6 (.1.2.3)		Potri.010G207200 [exp]	19.89	0.9016	UXS1.1
AT1G60970			SNARE-like superfamily protein...		Potri.003G043200 [exp]	22.71	0.9016
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Potri.012G073300 [exp]	26.83	0.8920	Pt-VFPP2.1
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.001G080400 [exp]	29.94	0.8871
AT1G26300			BSD domain-containing protein ...		Potri.010G137900 [exp]	33.34	0.8924
AT1G78870		UBC35 ,UBC13A	UBIQUITIN CONJUGATING ENZYME 1...		Potri.011G111400 [exp]	33.74	0.8831

Compare expression of checked genes

Potri.002G105050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.