Potri.002G106300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38060 62 / 1e-12 unknown protein
AT5G65480 61 / 7e-12 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032845 241 / 2e-82 AT4G38060 76 / 7e-18 unknown protein
Lus10001865 236 / 3e-80 AT4G38060 74 / 3e-17 unknown protein
PFAM info
Representative CDS sequence
>Potri.002G106300.5 pacid=42777302 polypeptide=Potri.002G106300.5.p locus=Potri.002G106300 ID=Potri.002G106300.5.v4.1 annot-version=v4.1
ATGGCTGTGGCATTTACCAATCTTTCATGGTGGTTATGGAGTGGAAAGCATCAGGAACCCAGAATTTCAAATGGGTCTTCTTTAAACGCAAGACCTGACT
CAGATTTGTGGGAATCGTCGGATACTCTGAAATTTCCTTTGGTTCAGACTAATGTGGCATCCTCCTCTAGAAGGGTTAAGAGAAAATGGCACAGCCGGGA
AGAGCGGAAAATTGATAGGGAATATGATGTTGTTCTTGTGCCATCTGATGGTGGCTGTGTTTCAGGGTCAGAGTCTGATGATTCGGATTATTCCATTGGG
TGGTTAGAGCCTCATGGACCTGAATTTCAGAGTGATGATGATACGGACAACAGTTTTGCTGTGCTGGTCCCATGTTATGGCCGTGTTCAAGATAATGCAT
TTGAGGATAAAAAGAACAATCTGTTTGGTGCTATTGTTAACATTCCAGATGGTAAGAGCCATTGCTCTTCCAGAGTTCTTTTTATATTTTGGTTGCTTCT
ACAAAATCTTCTATTTGCCTCTTCCACTGTTAGTGTAGGTTTCCTTATGCTGTGTTGA
AA sequence
>Potri.002G106300.5 pacid=42777302 polypeptide=Potri.002G106300.5.p locus=Potri.002G106300 ID=Potri.002G106300.5.v4.1 annot-version=v4.1
MAVAFTNLSWWLWSGKHQEPRISNGSSLNARPDSDLWESSDTLKFPLVQTNVASSSRRVKRKWHSREERKIDREYDVVLVPSDGGCVSGSESDDSDYSIG
WLEPHGPEFQSDDDTDNSFAVLVPCYGRVQDNAFEDKKNNLFGAIVNIPDGKSHCSSRVLFIFWLLLQNLLFASSTVSVGFLMLC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G38060 unknown protein Potri.002G106300 0 1
AT3G26890 unknown protein Potri.015G103500 1.41 0.7364
AT3G01170 Ribosomal protein L34e superfa... Potri.004G121900 1.73 0.7127
AT5G19430 RING/U-box superfamily protein... Potri.009G070600 17.60 0.6881
AT4G30210 AR2, ATR2 P450 reductase 2 (.1.2) Potri.018G092100 23.49 0.6883 PSC450.1
AT5G23590 DNAJ heat shock N-terminal dom... Potri.009G138100 28.16 0.6623
AT2G16710 Iron-sulphur cluster biosynthe... Potri.008G020400 38.57 0.6006
AT4G13830 J20 DNAJ-like 20 (.1.2) Potri.017G058400 40.00 0.6742 Pt-DNAJ.1
AT1G47750 PEX11A peroxin 11A (.1) Potri.014G042000 43.63 0.5742
AT1G56090 Tetratricopeptide repeat (TPR)... Potri.005G097300 53.24 0.6399
AT3G48330 ATPIMT1, PIMT1 Arabidopsis thaliana protein-l... Potri.015G086600 59.80 0.6075

Potri.002G106300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.