Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42740 126 / 8e-39 RPL16A ribosomal protein large subunit 16A (.1) AT5G45775 126 / 9e-39 Ribosomal L5P family protein (.1.2) AT4G18730 126 / 9e-39 RPL16B ribosomal protein L16B (.1) AT3G58700 126 / 9e-39 Ribosomal L5P family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G069200 [exp] 125 / 2e-38 AT2G42740 318 / 1e-112 ribosomal protein large subunit 16A (.1) Potri.011G068900 [exp] 125 / 2e-38 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2) Potri.006G181600 [exp] 125 / 2e-38 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2) Potri.006G181501 [exp] 125 / 2e-38 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033607 [exp] 125 / 3e-38 AT2G42740 362 / 7e-130 ribosomal protein large subunit 16A (.1) Lus10017648 [exp] 124 / 4e-38 AT2G42740 343 / 1e-122 ribosomal protein large subunit 16A (.1) Lus10020715 [exp] 124 / 8e-38 AT2G42740 359 / 5e-129 ribosomal protein large subunit 16A (.1) Lus10029824 [exp] 123 / 2e-37 AT2G42740 347 / 5e-124 ribosomal protein large subunit 16A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00673 [poplar] [flax] Ribosomal_L5_C ribosomal L5P family C-terminus
Representative CDS sequence Show only first row Show all	>Potri.002G109701.1 pacid=42779708 polypeptide=Potri.002G109701.1.p locus=Potri.002G109701 ID=Potri.002G109701.1.v4.1 annot-version=v4.1 ATGCATCTGCTTAAGAGTGGGTTGAAGGTGAAGGAGTACGAGCTTTTGAGGAGGAGCTTTAGTGACACTAGTTGCTTCGGTTTCGACATCCAAGAGCACA TTGATCTTGGCATCAAGTATGACCCTTCCACGGGTATTTATGGTCTTGACTTCTATGTGGTTTTGGAATGTCCTGGGTACCGTTTTCGTCGTCATCGCAG GTGCAAGTGA
AA sequence Show only first row Show all	>Potri.002G109701.1 pacid=42779708 polypeptide=Potri.002G109701.1.p locus=Potri.002G109701 ID=Potri.002G109701.1.v4.1 annot-version=v4.1 MHLLKSGLKVKEYELLRRSFSDTSCFGFDIQEHIDLGIKYDPSTGIYGLDFYVVLECPGYRFRRHRRCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42740		RPL16A	ribosomal protein large subuni...		Potri.002G109701 [exp]	0	1
AT5G05210			Surfeit locus protein 6 (.1.2)		Potri.008G173300 [exp]	2.00	0.9239
AT5G56000		Hsp81.4, AtHsp9...	HEAT SHOCK PROTEIN 90.4, HEAT ...		Potri.011G163932 [exp]	2.44	0.9368
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.014G167550 [exp]	3.87	0.9155
AT5G15200			Ribosomal protein S4 (.1.2)		Potri.006G209801 [exp]	5.19	0.9290
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Potri.002G020249 [exp]	9.94	0.8905
AT2G35790			unknown protein		Potri.010G219000 [exp]	21.21	0.8975
AT3G10950			Zinc-binding ribosomal protein...		Potri.001G149300 [exp]	22.44	0.9022	Pt-RPL37.1
AT1G26880			Ribosomal protein L34e superfa...		Potri.004G029400 [exp]	30.00	0.8879
AT1G61730	GeBP		DNA-binding storekeeper protei...		Potri.007G119800 [exp]	30.06	0.8333
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.008G013200 [exp]	32.71	0.8909	RPS28.2

Compare expression of checked genes

Potri.002G109701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.