Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59530 75 / 7e-18 bZIP ATBZIP4 basic leucine-zipper 4 (.1) AT3G49760 75 / 9e-18 bZIP ATBZIP5 basic leucine-zipper 5 (.1) AT4G37730 76 / 6e-17 bZIP ATBZIP7 basic leucine-zipper 7 (.1) AT2G18160 70 / 1e-15 bZIP GBF5, ATBZIP2 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) AT2G22850 68 / 1e-14 bZIP ATBZIP6 basic leucine-zipper 6 (.1.2) AT3G30530 66 / 6e-14 bZIP ATBZIP42 basic leucine-zipper 42 (.1) AT5G15830 63 / 7e-13 bZIP ATBZIP3 basic leucine-zipper 3 (.1) AT2G04038 62 / 1e-12 bZIP ATBZIP48 basic leucine-zipper 48 (.1) AT1G13600 62 / 1e-12 bZIP ATBZIP58 basic leucine-zipper 58 (.1) AT1G75390 61 / 4e-12 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G013400 [exp] 203 / 2e-68 AT1G59530 77 / 8e-19 basic leucine-zipper 4 (.1) Potri.014G007100 [exp] 88 / 2e-22 AT3G49760 120 / 6e-35 basic leucine-zipper 5 (.1) Potri.007G006900 [exp] 83 / 3e-20 AT2G22850 118 / 1e-32 basic leucine-zipper 6 (.1.2) Potri.008G113400 [exp] 65 / 1e-13 AT1G13600 139 / 2e-41 basic leucine-zipper 58 (.1) Potri.010G135200 [exp] 64 / 7e-13 AT3G30530 131 / 2e-38 basic leucine-zipper 42 (.1) Potri.005G119300 [exp] 62 / 8e-13 AT2G18160 130 / 3e-39 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) Potri.015G047700 [exp] 62 / 2e-12 AT5G60830 86 / 8e-21 basic leucine-zipper 70 (.1) Potri.009G119700 [exp] 59 / 2e-11 AT4G34590 154 / 9e-49 Arabidopsis thaliana basic leucine-zipper 11, G-box binding factor 6 (.1) Potri.004G111100 [exp] 58 / 4e-11 AT3G30530 156 / 9e-49 basic leucine-zipper 42 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007726 [exp] 125 / 2e-37 AT3G49760 84 / 3e-21 basic leucine-zipper 5 (.1) Lus10018662 [exp] 119 / 6e-35 AT3G49760 82 / 2e-20 basic leucine-zipper 5 (.1) Lus10011722 [exp] 90 / 8e-23 AT3G49760 120 / 2e-34 basic leucine-zipper 5 (.1) Lus10011557 [exp] 72 / 1e-16 AT3G49760 87 / 9e-23 basic leucine-zipper 5 (.1) Lus10029101 [exp] 67 / 5e-14 AT3G30530 148 / 5e-45 basic leucine-zipper 42 (.1) Lus10013059 [exp] 67 / 5e-14 AT3G30530 147 / 8e-45 basic leucine-zipper 42 (.1) Lus10019273 [exp] 61 / 5e-12 AT2G22850 94 / 2e-23 basic leucine-zipper 6 (.1.2) Lus10041780 [exp] 61 / 8e-12 AT1G75390 135 / 2e-40 basic leucine-zipper 44 (.1.2) Lus10028333 [exp] 59 / 4e-11 AT1G75390 134 / 5e-40 basic leucine-zipper 44 (.1.2) Lus10024279 [exp] 58 / 5e-11 AT1G75390 166 / 6e-53 basic leucine-zipper 44 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0018 [poplar] [flax] bZIP PF00170 [poplar] [flax] bZIP_1 bZIP transcription factor
Representative CDS sequence Show only first row Show all	>Potri.002G115900.1 pacid=42779033 polypeptide=Potri.002G115900.1.p locus=Potri.002G115900 ID=Potri.002G115900.1.v4.1 annot-version=v4.1 ATGTCCTTTGCCCAGGAAGCAGTCCAGTTCGAGTGCCCGGTTCAAGGCCCTGGGTTCACGGACAATGAAATTCAAGAACTCTTATCTCTCCTCCGGTCAC CCTCTCCTGGCCAGAACTCTGGTTCAAGCGGATCTAACCAAGCACTTTACTCTCTCGACGAGAGGAAGCGCAGGCGCATGTTATCTAACCGGGAGTCAGC CCGAAGGTCCCGCTGGAGAAAGAAGAGGCATTTAGAGGACCTCACACAACAATTGAACCGGTTGAAAATTGCAAACCGGGAGCTCAAGAACCGGTTGGGT TCAATTTTAAACCAGTCTCACGTATTATGGAGAGAGAACGACCGCTTAATGCTCGAATCTATAGCCCTCAAGTCCAGACTTTCGGATTTATGCTATGTTT TCGCTGCCATGCAAAAGTCACAACAACAATGTTCCTCATTATAG
AA sequence Show only first row Show all	>Potri.002G115900.1 pacid=42779033 polypeptide=Potri.002G115900.1.p locus=Potri.002G115900 ID=Potri.002G115900.1.v4.1 annot-version=v4.1 MSFAQEAVQFECPVQGPGFTDNEIQELLSLLRSPSPGQNSGSSGSNQALYSLDERKRRRMLSNRESARRSRWRKKRHLEDLTQQLNRLKIANRELKNRLG SILNQSHVLWRENDRLMLESIALKSRLSDLCYVFAAMQKSQQQCSSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G59530	bZIP	ATBZIP4	basic leucine-zipper 4 (.1)		Potri.002G115900 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Potri.004G067900 [exp]	1.41	0.9300	Pt-ACTI.1
AT1G02930		ATGST1, GST1, E...	EARLY RESPONSIVE TO DEHYDRATIO...		Potri.002G207479 [exp]	4.24	0.8538
AT1G49320		ATUSPL1	unknown seed protein like 1 (....		Potri.009G114600 [exp]	4.69	0.9085
AT3G24330			O-Glycosyl hydrolases family 1...		Potri.018G072300 [exp]	5.65	0.8865
AT2G05760			Xanthine/uracil permease famil...		Potri.014G157800 [exp]	6.63	0.8466
AT1G14930			Polyketide cyclase/dehydrase a...		Potri.008G131200 [exp]	8.66	0.8878	MLP.3
AT5G06700		TBR	TRICHOME BIREFRINGENCE, Plant ...		Potri.001G010900 [exp]	10.24	0.7862
AT2G35790			unknown protein		Potri.008G042800 [exp]	11.48	0.8624
AT5G19875			unknown protein		Potri.001G009200 [exp]	12.00	0.8792
					Potri.003G026650 [exp]	12.84	0.8268

Compare expression of checked genes

Potri.002G115900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.