Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45310 98 / 9e-25 GAE4 UDP-D-glucuronate 4-epimerase 4 (.1) AT1G02000 96 / 8e-24 GAE2 UDP-D-glucuronate 4-epimerase 2 (.1) AT4G00110 82 / 5e-19 GAE3 UDP-D-glucuronate 4-epimerase 3 (.1) AT4G30440 76 / 7e-17 GAE1 UDP-D-glucuronate 4-epimerase 1 (.1) AT4G12250 72 / 2e-15 GAE5 UDP-D-glucuronate 4-epimerase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G146500 [exp] 246 / 2e-81 AT1G02000 724 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Potri.014G068400 [exp] 227 / 5e-74 AT1G02000 714 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Potri.003G114600 [exp] 99 / 6e-25 AT4G12250 587 / 0.0 UDP-D-glucuronate 4-epimerase 5 (.1) Potri.012G128200 [exp] 91 / 4e-22 AT1G02000 544 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Potri.006G178500 [exp] 79 / 1e-17 AT4G30440 757 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Potri.001G320000 [exp] 79 / 1e-17 AT3G23820 714 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1) Potri.018G100400 [exp] 75 / 3e-16 AT4G30440 771 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Potri.017G059100 [exp] 57 / 5e-10 AT3G23820 724 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009288 [exp] 122 / 1e-33 AT4G00110 704 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10015876 [exp] 115 / 9e-31 AT4G00110 751 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10000787 [exp] 109 / 7e-29 AT4G00110 731 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10030281 [exp] 99 / 5e-25 AT4G00110 753 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1) Lus10008893 [exp] 93 / 6e-23 AT4G30440 767 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Lus10038911 [exp] 84 / 4e-20 AT1G02000 440 / 8e-156 UDP-D-glucuronate 4-epimerase 2 (.1) Lus10032391 [exp] 86 / 5e-20 AT1G02000 620 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1) Lus10023077 [exp] 84 / 9e-20 AT1G02000 244 / 2e-77 UDP-D-glucuronate 4-epimerase 2 (.1) Lus10015496 [exp] 83 / 3e-19 AT4G30440 764 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1) Lus10023213 [exp] 77 / 2e-18 AT4G30440 209 / 1e-66 UDP-D-glucuronate 4-epimerase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.002G116750.1 pacid=42779650 polypeptide=Potri.002G116750.1.p locus=Potri.002G116750 ID=Potri.002G116750.1.v4.1 annot-version=v4.1 ATGAACAAGGAATGTTTTCCAAGTACTGAACCAAAAAAATTCAACTCATCTTGCAACAGCCTTCTTGTCTCCATAGTAACTGAGGTACCACGGCACGAAT TTCTTCAACCCTGTCTGCAGATCCGTGGTAGGCTTATATCCAAATTCCTTCTGAGCATAACTAATATTTGCGTGTGTATATGGAACATCCCCGTTGCGTG GAAACTTCATAACATTCCTTTTAGCCTTAACCTTCAAAAGCCTTTCCAAAATACTGACAAGATCAGTAACTGGCACAGAAGATGTATTCCCCAAATTGAA AACCCTCAATTGTGCCGGCCCTTTCTTCTTCCCTCCACTCCCGGTACTCTTCTCTGCTGTATCCAACGAACCCAAACAACCCTTCACAATATCATCAATG TAGGTAAAATCCCTAGCAACAGTCCCGTGATTCGCAGCCAGTAA
AA sequence Show only first row Show all	>Potri.002G116750.1 pacid=42779650 polypeptide=Potri.002G116750.1.p locus=Potri.002G116750 ID=Potri.002G116750.1.v4.1 annot-version=v4.1 MNKECFPSTEPKKFNSSCNSLLVSIVTEVPRHEFLQPCLQIRGRLISKFLLSITNICVCIWNIPVAWKLHNIPFSLNLQKPFQNTDKISNWHRRCIPQIE NPQLCRPFLLPSTPGTLLCCIQRTQTTLHNIINVGKIPSNSPVIRSQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45310		GAE4	UDP-D-glucuronate 4-epimerase ...		Potri.002G116750 [exp]	0	1
AT5G54240			Protein of unknown function (D...		Potri.001G408001 [exp]	2.82	0.9434
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Potri.007G072750 [exp]	8.12	0.9141
AT5G49720		TSD1, IRX2, DEC...	TUMOROUS SHOOT DEVELOPMENT 1, ...		Potri.001G078900 [exp]	19.59	0.9004	KOR1.2
AT3G11780			MD-2-related lipid recognition...		Potri.006G201400 [exp]	20.49	0.8979
AT5G23860		TUB8, b-TUB	tubulin beta 8 (.1.2)		Potri.016G107300 [exp]	20.49	0.9015
AT5G61480		PXY, TDR	TDIF receptor, PHLOEM INTERCAL...		Potri.001G126100 [exp]	21.49	0.8971
AT3G22070			proline-rich family protein (....		Potri.007G120101 [exp]	23.23	0.8897
AT3G20820			Leucine-rich repeat (LRR) fami...		Potri.001G269800 [exp]	23.97	0.8854
AT4G16450			unknown protein		Potri.016G009600 [exp]	26.60	0.8967
AT4G39730			Lipase/lipooxygenase, PLAT/LH2...		Potri.003G107100 [exp]	28.14	0.8871

Compare expression of checked genes

Potri.002G116750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.