Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3) AT5G62300 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2) AT3G45030 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1) AT3G13120 40 / 3e-05 Ribosomal protein S10p/S20e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G146600 [exp] 131 / 2e-41 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.012G128300 [exp] 127 / 5e-40 AT5G62300 222 / 2e-76 Ribosomal protein S10p/S20e family protein (.1.2) Potri.015G129800 [exp] 127 / 1e-39 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.011G092800 [exp] 40 / 3e-05 AT3G13120 231 / 1e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.001G365600 [exp] 37 / 0.0004 AT3G13120 237 / 4e-80 Ribosomal protein S10p/S20e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031706 [exp] 122 / 7e-38 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1) Lus10031705 [exp] 120 / 6e-37 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031126 [exp] 119 / 7e-37 AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1) Lus10038910 [exp] 119 / 2e-36 AT5G62300 210 / 8e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10027194 [exp] 109 / 1e-32 AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031125 [exp] 97 / 3e-28 AT5G62300 113 / 6e-34 Ribosomal protein S10p/S20e family protein (.1.2) Lus10016604 [exp] 40 / 2e-05 AT3G13120 240 / 3e-81 Ribosomal protein S10p/S20e family protein (.1.2) Lus10007111 [exp] 37 / 0.0004 AT3G13120 226 / 3e-75 Ribosomal protein S10p/S20e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00338 [poplar] [flax] Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence Show only first row Show all	>Potri.002G116900.2 pacid=42777253 polypeptide=Potri.002G116900.2.p locus=Potri.002G116900 ID=Potri.002G116900.2.v4.1 annot-version=v4.1 ATGAAGGGACCCGTGAGGATACCAACCAAAGTTCTCCAAATTACTACTAGAAAAGCTCCATGTGGTGAAGGAACAAGCACTTGGGATGGTTTTGAGCTCC GCATTCATAAACGAGTGGTTGATCTTTTTAGCTCAGCTGAAGTGGTGAAACAGATAACTTCCATTACCATTGAACCTGGCGTGGAGGTTGAGGTTACAAT TGCAAGCTAA
AA sequence Show only first row Show all	>Potri.002G116900.2 pacid=42777253 polypeptide=Potri.002G116900.2.p locus=Potri.002G116900 ID=Potri.002G116900.2.v4.1 annot-version=v4.1 MKGPVRIPTKVLQITTRKAPCGEGTSTWDGFELRIHKRVVDLFSSAEVVKQITSITIEPGVEVEVTIAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47370			Ribosomal protein S10p/S20e fa...		Potri.002G116900 [exp]	0	1
AT5G20900	ZIM	TIFY3B, JAZ12	jasmonate-zim-domain protein 1...		Potri.006G217200 [exp]	2.00	0.8103
AT1G19360		RRA3	reduced residual arabinose 3, ...		Potri.002G134400 [exp]	3.74	0.7530
AT5G08350			GRAM domain-containing protein...		Potri.007G075700 [exp]	4.89	0.7755
AT4G16990		RLM3	RESISTANCE TO LEPTOSPHAERIA MA...		Potri.013G085201 [exp]	5.47	0.7534
AT5G47920			unknown protein		Potri.003G160300 [exp]	8.83	0.8010
AT4G27760		FEY3, FEY	FOREVER YOUNG, NAD(P)-binding ...		Potri.003G182000 [exp]	12.48	0.7708
AT5G06770	C3HZnF		KH domain-containing protein /...		Potri.003G213200 [exp]	12.96	0.7297
AT5G16020		GEX3	gamete-expressed 3 (.1)		Potri.004G104500 [exp]	27.00	0.7515
AT4G25570		ACYB-2	Cytochrome b561/ferric reducta...		Potri.015G143700 [exp]	31.08	0.7055
					Potri.001G293200 [exp]	36.44	0.7520

Compare expression of checked genes

Potri.002G116900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.