Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33865 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1) AT3G44010 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1) AT3G43980 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G017701 [exp] 118 / 1e-37 AT4G33865 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1) Potri.001G295902 [exp] 118 / 2e-37 AT4G33865 108 / 1e-33 Ribosomal protein S14p/S29e family protein (.1) Potri.004G043600 [exp] 114 / 1e-35 AT4G33865 103 / 1e-31 Ribosomal protein S14p/S29e family protein (.1) Potri.009G090000 [exp] 114 / 1e-35 AT4G33865 104 / 1e-31 Ribosomal protein S14p/S29e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013779 [exp] 108 / 2e-33 AT3G44010 102 / 5e-31 Ribosomal protein S14p/S29e family protein (.1) Lus10039155 [exp] 108 / 2e-33 AT3G44010 102 / 5e-31 Ribosomal protein S14p/S29e family protein (.1) Lus10013781 [exp] 112 / 6e-32 AT1G33470 182 / 1e-55 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10004252 [exp] 114 / 2e-31 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00253 [poplar] [flax] Ribosomal_S14 Ribosomal protein S14p/S29e
Representative CDS sequence Show only first row Show all	>Potri.002G119600.1 pacid=42779356 polypeptide=Potri.002G119600.1.p locus=Potri.002G119600 ID=Potri.002G119600.1.v4.1 annot-version=v4.1 ATGGGGCACTCAAATATCTGGAACTCGCATCCCAAGAACTACGGTCCTGGATCTCGCACCTGCCGGGTGTGTGGAAACCCACATGGGATAATCAGGAAGT ATGGACTGATGTGTTGTAGGCAGTGCTTCCGCAGCAATGCCAAGGAAATAGGCTTCATCAAGTACCGCTGA
AA sequence Show only first row Show all	>Potri.002G119600.1 pacid=42779356 polypeptide=Potri.002G119600.1.p locus=Potri.002G119600 ID=Potri.002G119600.1.v4.1 annot-version=v4.1 MGHSNIWNSHPKNYGPGSRTCRVCGNPHGIIRKYGLMCCRQCFRSNAKEIGFIKYR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.002G119600 [exp]	0	1
AT4G25740			RNA binding Plectin/S10 domain...		Potri.005G040100 [exp]	1.41	0.9579
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Potri.018G063600 [exp]	2.44	0.9289	TIF3.1
AT2G05840		PAA2	20S proteasome subunit PAA2 (....		Potri.006G140400 [exp]	4.12	0.9097
AT5G57290			60S acidic ribosomal protein f...		Potri.003G010200 [exp]	4.47	0.9363
AT3G26400		EIF4B1	eukaryotic translation initiat...		Potri.002G198700 [exp]	5.91	0.9288
AT2G19740			Ribosomal protein L31e family ...		Potri.001G269600 [exp]	6.00	0.9459
AT2G27710			60S acidic ribosomal protein f...		Potri.004G185800 [exp]	7.61	0.9495
AT1G68350			unknown protein		Potri.008G122700 [exp]	7.74	0.9124
AT1G24050			RNA-processing, Lsm domain (.1...		Potri.010G095601 [exp]	8.83	0.8969
AT2G39960			Microsomal signal peptidase 25...		Potri.010G192700 [exp]	9.79	0.9216

Compare expression of checked genes

Potri.002G119600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.