Potri.002G121800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G28455 37 / 0.0002 CLE25 CLAVATA3/ESR-RELATED 25 (.1)
AT1G69588 36 / 0.0007 CLE45 CLAVATA3/ESR-RELATED 45 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G021250 108 / 1e-32 AT3G28455 39 / 3e-05 CLAVATA3/ESR-RELATED 25 (.1)
Potri.017G074600 39 / 6e-05 AT3G28455 67 / 3e-16 CLAVATA3/ESR-RELATED 25 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.002G121800.2 pacid=42777174 polypeptide=Potri.002G121800.2.p locus=Potri.002G121800 ID=Potri.002G121800.2.v4.1 annot-version=v4.1
ATGCCCAAATCATTTATAGGCAGAAAAATGCACTATCAACAGTCCCCTCGAGTCTTTGTGTTGCAGAAGCCAATGGTTATACTTCTTCTTGTACTGTTCG
TCTCAGGAGACCGGAAAGAAGAGACAACGGTGAATGTTCATGGCTTGCAAAACCAGCAGCCGCCAAGTAGCACAGAGAAGCAGCAACGTTTAAGGCACTC
ATTTGATACGTTCTTTTCAAGCAAAAGAAAAGTTCCAAATGCTTCAGACCCTCTTCACAACCGCTGA
AA sequence
>Potri.002G121800.2 pacid=42777174 polypeptide=Potri.002G121800.2.p locus=Potri.002G121800 ID=Potri.002G121800.2.v4.1 annot-version=v4.1
MPKSFIGRKMHYQQSPRVFVLQKPMVILLLVLFVSGDRKEETTVNVHGLQNQQPPSSTEKQQRLRHSFDTFFSSKRKVPNASDPLHNR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.002G121800 0 1
AT3G14250 RING/U-box superfamily protein... Potri.003G187700 10.77 0.7165
AT2G47680 C3HZnF zinc finger (CCCH type) helica... Potri.017G031800 11.18 0.6926
AT5G45030 Trypsin family protein (.1.2) Potri.011G143200 16.15 0.6794
AT1G23220 Dynein light chain type 1 fami... Potri.008G133000 17.94 0.7076
AT4G24060 DOF AtDof4,6 Dof-type zinc finger DNA-bindi... Potri.015G009300 21.54 0.6802
AT3G53850 Uncharacterised protein family... Potri.006G090400 21.90 0.6733
AT2G30933 Carbohydrate-binding X8 domain... Potri.005G202400 24.14 0.6788
AT2G19090 Protein of unknown function (D... Potri.006G077000 28.35 0.6943
AT2G26520 unknown protein Potri.004G144400 37.76 0.6520
AT5G63090 AS2 LOBB, LOB Lateral organ boundaries (LOB)... Potri.012G083500 46.36 0.6603

Potri.002G121800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.