Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-MAF1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47200 111 / 2e-31 WPP2 WPP domain protein 2 (.1) AT5G43070 104 / 6e-29 WPP1 WPP domain protein 1 (.1) AT5G27940 75 / 2e-17 WPP3 WPP domain protein 3 (.1) AT5G19320 57 / 4e-10 RANGAP2 RAN GTPase activating protein 2 (.1) AT3G63130 51 / 5e-08 ATRANGAP1, RANGAP1 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G021900 [exp] 172 / 3e-55 AT1G47200 115 / 1e-32 WPP domain protein 2 (.1) Potri.010G091100 [exp] 65 / 7e-13 AT5G19320 646 / 0.0 RAN GTPase activating protein 2 (.1) Potri.002G052900 [exp] 54 / 8e-09 AT3G63130 664 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2) Potri.005G209600 [exp] 52 / 2e-08 AT3G63130 667 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009747 [exp] 121 / 1e-35 AT1G47200 119 / 1e-34 WPP domain protein 2 (.1) Lus10010235 [exp] 112 / 4e-32 AT1G47200 124 / 2e-36 WPP domain protein 2 (.1) Lus10042643 [exp] 105 / 3e-29 AT1G47200 125 / 4e-37 WPP domain protein 2 (.1) Lus10010523 [exp] 60 / 6e-11 AT5G19320 666 / 0.0 RAN GTPase activating protein 2 (.1) Lus10034066 [exp] 59 / 9e-11 AT5G19320 669 / 0.0 RAN GTPase activating protein 2 (.1) Lus10014670 [exp] 56 / 2e-09 AT3G63130 717 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2) Lus10006930 [exp] 55 / 3e-09 AT3G63130 712 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF13943 [poplar] [flax] WPP WPP domain
Representative CDS sequence Show only first row Show all	>Potri.002G122000.1 pacid=42779699 polypeptide=Potri.002G122000.1.p locus=Potri.002G122000 ID=Potri.002G122000.1.v4.1 annot-version=v4.1 ATGTCCGACTCTGAAACTACAACCACCGTCTCCACCACTGCACCGCCTCCAGAGGACGATTCATCCGCGACGGATACAAAGAAGCAGGCAAGAAATGCCA TTTCCTTTAGCATCTGGCCACTGACTCAGCGTACACGCGACTCAGTAATCACCCGCCTAATCGAGACCTTGTCAACGACTTCCGTTCTCTCCAAGCGCTA CGGTACCGTTCCCCATGACGAGGCCTCCGAAGTCTCCCGCCGCATTGAGGAGGAGGCCTTTTCTGTTGCCACCTCCTCGTCATCGTCGGAGGATGACGGA CTCGAGGTTGTCCAGCTTTACTCTAAGGAGATCAGTAAGCGGATGTTAGAGACCGTCAAGGCTCGATCTGAATCAAGCGCAAATGGTGATAATAGTGCAG CGAAGACGGTGAGTGCTGATGTGACGCCAACATCGGCGGCGAGCGAGGAGGTTTTAAGTTCTGTTGAGACTGAAGCAGCTTGA
AA sequence Show only first row Show all	>Potri.002G122000.1 pacid=42779699 polypeptide=Potri.002G122000.1.p locus=Potri.002G122000 ID=Potri.002G122000.1.v4.1 annot-version=v4.1 MSDSETTTTVSTTAPPPEDDSSATDTKKQARNAISFSIWPLTQRTRDSVITRLIETLSTTSVLSKRYGTVPHDEASEVSRRIEEEAFSVATSSSSSEDDG LEVVQLYSKEISKRMLETVKARSESSANGDNSAAKTVSADVTPTSAASEEVLSSVETEAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47200		WPP2	WPP domain protein 2 (.1)		Potri.002G122000 [exp]	0	1	Pt-MAF1.1
AT5G43190			Galactose oxidase/kelch repeat...		Potri.002G118700 [exp]	1.00	0.9483
AT4G17960			unknown protein		Potri.003G090600 [exp]	2.23	0.9176
AT5G23750			Remorin family protein (.1.2)		Potri.001G107000 [exp]	2.82	0.9294
					Potri.005G078900 [exp]	5.47	0.9169
AT1G55160			unknown protein		Potri.001G200200 [exp]	8.36	0.9048
AT3G59110			Protein kinase superfamily pro...		Potri.002G059000 [exp]	8.71	0.9186
AT3G51730			saposin B domain-containing pr...		Potri.006G107300 [exp]	9.48	0.9037
AT4G27435			Protein of unknown function (D...		Potri.011G122700 [exp]	9.79	0.9229
AT1G72220			RING/U-box superfamily protein...		Potri.002G101800 [exp]	9.94	0.9097
AT5G57330			Galactose mutarotase-like supe...		Potri.006G165400 [exp]	11.83	0.8976

Compare expression of checked genes

Potri.002G122000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.