Potri.002G122900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16150 541 / 0 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT5G08100 380 / 1e-132 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT5G61540 88 / 2e-19 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G00590 87 / 4e-19 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G022900 599 / 0 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.012G063400 355 / 1e-122 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G080600 92 / 2e-20 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G191900 79 / 2e-16 AT5G61540 497 / 2e-177 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024795 536 / 0 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10034655 367 / 4e-127 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10034668 358 / 9e-124 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10017879 113 / 3e-30 AT5G08100 157 / 4e-48 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10040935 100 / 1e-23 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 90 / 6e-20 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009560 80 / 2e-16 AT5G61540 518 / 0.0 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020385 77 / 3e-15 AT5G61540 429 / 1e-147 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Potri.002G122900.1 pacid=42777170 polypeptide=Potri.002G122900.1.p locus=Potri.002G122900 ID=Potri.002G122900.1.v4.1 annot-version=v4.1
ATGGGAGGGTGGGCTATAGCGGTGCATGGAGGCGCTGGTGTCGACCCAAATCTCCCACAAGAGAGACAAGAGGAGGCCAAAAAACTCCTCGCTCGCTGCC
TTGATCTTGGCATCTCTGCTCTTCGCTCTAATCTTCCCGCTATCGATGTTGTCGAACTTGTTGTGAGAGAATTGGAAACGGATCCTCTGTTTAATTCTGG
GCGTGGATCTGCTTTAACAGAGAACGGAACAGTGGAAATGGAAGCCAGCATAATGGACGGGCCAAAGAGAAGATGCGGTGCCGTATCCGGTTTAACAACA
GTGAAAAACCCAATCTCTCTCGCAAGACTTGTGATGGAGAAATCTCCTCATTCCTATCTTGCTTTTTCTGGCGCTGAGGAATTTGCCAGGCACCAGGGTG
TTGAGACGGTGGACAATGGCTATTTTATAACGGAGGAAAACTTGGGGATGTTGAAGTTAGCAAGAGAAGCCAACTCCATCCTGTTTGATTACAGGATCCC
AGCCGTTGGATTGGAAAGCTGCAGTGTGGGGCCCCCTGATGACAATCTCTTGGCAATGAACGGACTCCCAATCAGCCTGTATGCGCCAGAAACAGTGGGG
TGTGTGGTGGTGGACAGCCAAGGGAGGTGTGCTGCAGCCACGTCAACAGGTGGGCTCATGAACAAAATGGCAGGTCGTATTGGTGACTCGCCCCTGATCG
GTGCTGGGACCTACGCTTGTGATCTTTGTGGGGTCTCTTGCACAGGAGAAGGAGAGGCCATCATACGTGGGACACTAGCGCGCGATGTAGCGGCGGTGAT
GGAGTACAAGGGATTGAGCCTGCAAGAAGCAGTGGATTTTGTTGTGAACGAGAGGCTTGATGAAGGGCGAGCTGGTTTGATAGCAGTATCCAGAAACGGG
GAAGTGGCGTGTCGTTTTAACACCAACGCGATGTTTAGGGGATTTGCCACTGAAGATGGTTTCACAGAAGTCGGTATCTGGGACTGA
AA sequence
>Potri.002G122900.1 pacid=42777170 polypeptide=Potri.002G122900.1.p locus=Potri.002G122900 ID=Potri.002G122900.1.v4.1 annot-version=v4.1
MGGWAIAVHGGAGVDPNLPQERQEEAKKLLARCLDLGISALRSNLPAIDVVELVVRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTT
VKNPISLARLVMEKSPHSYLAFSGAEEFARHQGVETVDNGYFITEENLGMLKLAREANSILFDYRIPAVGLESCSVGPPDDNLLAMNGLPISLYAPETVG
CVVVDSQGRCAAATSTGGLMNKMAGRIGDSPLIGAGTYACDLCGVSCTGEGEAIIRGTLARDVAAVMEYKGLSLQEAVDFVVNERLDEGRAGLIAVSRNG
EVACRFNTNAMFRGFATEDGFTEVGIWD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G16150 ASPGB1 asparaginase B1, N-terminal nu... Potri.002G122900 0 1
AT3G06240 F-box family protein (.1) Potri.017G058900 1.41 0.9700
AT3G48660 Protein of unknown function (D... Potri.001G058001 6.16 0.9633
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Potri.003G114400 7.21 0.9488
AT1G07370 ATPCNA1, PCNA1 proliferating cellular nuclear... Potri.010G193950 8.48 0.9551
AT3G03430 Calcium-binding EF-hand family... Potri.014G030800 8.94 0.9604
AT3G51030 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOX... Potri.002G030000 9.05 0.9122 PtrTrxh1
AT1G77700 Pathogenesis-related thaumatin... Potri.001G210400 9.94 0.9607
AT2G40230 HXXXD-type acyl-transferase fa... Potri.008G071200 10.00 0.8970
AT4G05430 Carbohydrate-binding X8 domain... Potri.019G007800 12.80 0.9606
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.004G209200 16.09 0.9585

Potri.002G122900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.