Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57870 283 / 1e-99 SCE1A, SCE1, AHUS5, EMB1637, ATSCE1 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) AT2G02760 121 / 1e-35 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 119 / 8e-35 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 115 / 4e-33 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT1G64230 102 / 5e-28 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT3G08690 100 / 1e-27 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G41700 100 / 1e-27 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT4G27960 100 / 3e-27 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G53300 99 / 5e-27 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G56150 94 / 4e-25 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G024950 [exp] 322 / 4e-115 AT3G57870 291 / 6e-103 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.014G024801 [exp] 318 / 3e-113 AT3G57870 251 / 5e-87 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.005G141100 [exp] 289 / 6e-102 AT3G57870 303 / 1e-107 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Potri.015G064000 [exp] 124 / 5e-37 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.013G064400 [exp] 122 / 5e-36 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.019G039200 [exp] 121 / 1e-35 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.001G094900 [exp] 102 / 2e-28 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 101 / 6e-28 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 101 / 6e-28 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009376 [exp] 292 / 4e-103 AT3G57870 306 / 7e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10019327 [exp] 292 / 4e-103 AT3G57870 308 / 2e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10019328 [exp] 290 / 3e-102 AT3G57870 308 / 3e-109 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10009377 [exp] 289 / 9e-102 AT3G57870 306 / 1e-108 SUMO CONJUGATING ENZYME 1A, EMBRYO DEFECTIVE 1637, sumo conjugation enzyme 1 (.1) Lus10036727 [exp] 120 / 3e-35 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 120 / 3e-35 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 119 / 1e-34 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 116 / 1e-33 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10009422 [exp] 103 / 1e-28 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10028700 [exp] 103 / 1e-28 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.002G123600.1 pacid=42777466 polypeptide=Potri.002G123600.1.p locus=Potri.002G123600 ID=Potri.002G123600.1.v4.1 annot-version=v4.1 ATGTCAGGAGGAGGCATAGCTCGTGGTCGTCTTGCTGAAGAGAGAAAGGCATGGCGTAAGAATCACCCTCACGGTTTTGTGGCTAAGCCTGATAATGCTC CAGATGGTTCTCTAGATTTGATGATGTGGAAGTGCATTATACCTGGCAAACCCGGGACTGATTGGGAGGGTGGCTACTTCCCCCTCACTCTTCATTTCAG TGAGGACTACCCAAGCAAACCTCCAAAGTGCAAGTTCCCCCAAGGTTTCTTCCACCCTAATGTCTACCCTTCAGGAACTGTGTGCTTATCTATCCTCAAT GAGGACTATGGCTGGAGACCAGCCATTACAGTGAAGCAAATATTAATTGGCATTCAGGATTTGCTTGATCAACCAAATCCTTCTGATCCTGCACAAACTG ATGGCTATCAGCTTTTTGTCCAGGACCCTGCTGAGTACAGGAGAAGGGTGCGCCAACAAGCCAAGCTATACCCACCTACGCTCTGA
AA sequence Show only first row Show all	>Potri.002G123600.1 pacid=42777466 polypeptide=Potri.002G123600.1.p locus=Potri.002G123600 ID=Potri.002G123600.1.v4.1 annot-version=v4.1 MSGGGIARGRLAEERKAWRKNHPHGFVAKPDNAPDGSLDLMMWKCIIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN EDYGWRPAITVKQILIGIQDLLDQPNPSDPAQTDGYQLFVQDPAEYRRRVRQQAKLYPPTL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Potri.002G123600 [exp]	0	1
AT5G18850			unknown protein		Potri.008G197300 [exp]	12.24	0.7327
AT5G17550		AtPEX19-2, PEX1...	peroxin 19-2 (.1)		Potri.003G077000 [exp]	12.44	0.7146
AT1G54150			E3 Ubiquitin ligase family pro...		Potri.003G065500 [exp]	13.11	0.7498
AT5G16200			50S ribosomal protein-related ...		Potri.017G117866 [exp]	25.25	0.6691
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Potri.014G024950 [exp]	26.60	0.7256
AT1G69030			BSD domain-containing protein ...		Potri.008G111900 [exp]	31.96	0.6303
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Potri.001G050100 [exp]	32.86	0.7135
AT1G01350	C3HZnF		Zinc finger (CCCH-type/C3HC4-t...		Potri.014G097300 [exp]	33.94	0.7147
AT2G40600			appr-1-p processing enzyme fam...		Potri.013G092700 [exp]	44.15	0.6834
AT5G13190		AtGILP	GSH-induced LITAF domain prote...		Potri.003G165900 [exp]	44.19	0.6359

Compare expression of checked genes

Potri.002G123600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.