Potri.002G126800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33350 374 / 7e-132 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
AT3G23710 156 / 7e-46 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G030000 491 / 3e-178 AT4G33350 359 / 5e-126 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G236000 164 / 3e-49 AT3G23710 351 / 7e-122 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006487 373 / 2e-131 AT4G33350 358 / 2e-125 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10009759 373 / 4e-131 AT4G33350 355 / 3e-124 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10022378 166 / 1e-49 AT3G23710 305 / 2e-103 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10007784 143 / 2e-41 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Potri.002G126800.1 pacid=42778100 polypeptide=Potri.002G126800.1.p locus=Potri.002G126800 ID=Potri.002G126800.1.v4.1 annot-version=v4.1
ATGGAACCCTCTGGACCCTCAAACCCTCTCTTATCTCTCTCAACCTTCATCCACCATCACTGCCTCCGTCTCGGTGCCGAATTCTCCACTCGTATCAGCG
ATACCACTCGATTCCTAGGCGGCAACCTCCCTCCACCTAGGCGGCTCTGCCTGGCGCCATCGCCGCCTTTCGCTTCTGTATCGCAGCCGAAACAGACAGC
TACAACCGCCAATCTCAGCTCGGACCACGTCGCGAAAACTCTGGCAGGCACGGCCGTGTACACAGTGAGCAATTCCAACAACGAGTTCGTGCTCATCTCG
GATCCTAATGGAGCTAAGTCCATTGGTTTGCTTTGCTTTCGGCAAGAAGACGCTGAAGCATTTCTTGCTCAGGTTAGGCTTCGGAGAAGGGAGTTGCGAA
GCCAAGCTAAGGTTGTGCCTATCACACTCGACCAGGTGTACATGCTGAAGGTTGAAGGAATTGCATTTCGTTTTTTACCTGATCCGGTTCAAATAAAGAA
TGCACTAGAGCTCAAAGCTGTTGATATCAGGAGTGGCTTTGATGGAGTTCCTGTTTTCCAGTCAGACCTTCTGGTTGTGAAGAAGAAAAACAAGAGATAT
TGCCCAATATATTTTCAAAAGGAAGATATAGAAAAAGAATTGTCGAAGGTCTCAAAGGCATCAAGGGGCCCCAGTCTTTCTCAACATATTATGGTGGGAA
GTTTAGAGGATGTTCTTAAAAAAATGGAGATAAGCGAGAAAAAATCTGGCTGGGAAGATCTGATTTTCATTCCACCTGGTAAAAGCCATTCTCAACACAT
TCATGAGATAACTAAGGTATGA
AA sequence
>Potri.002G126800.1 pacid=42778100 polypeptide=Potri.002G126800.1.p locus=Potri.002G126800 ID=Potri.002G126800.1.v4.1 annot-version=v4.1
MEPSGPSNPLLSLSTFIHHHCLRLGAEFSTRISDTTRFLGGNLPPPRRLCLAPSPPFASVSQPKQTATTANLSSDHVAKTLAGTAVYTVSNSNNEFVLIS
DPNGAKSIGLLCFRQEDAEAFLAQVRLRRRELRSQAKVVPITLDQVYMLKVEGIAFRFLPDPVQIKNALELKAVDIRSGFDGVPVFQSDLLVVKKKNKRY
CPIYFQKEDIEKELSKVSKASRGPSLSQHIMVGSLEDVLKKMEISEKKSGWEDLIFIPPGKSHSQHIHEITKV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G33350 AtTic22-IV translocon at the inner envelo... Potri.002G126800 0 1
AT3G25470 bacterial hemolysin-related (.... Potri.014G175500 3.16 0.9295
AT3G13470 Cpn60beta2 chaperonin-60beta2, TCP-1/cpn6... Potri.001G002500 6.32 0.9122
AT5G17710 EMB1241 embryo defective 1241, Co-chap... Potri.013G067900 8.48 0.9195
AT3G09085 Protein of unknown function (D... Potri.006G096200 11.48 0.9000
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Potri.003G191000 13.26 0.9298
AT3G24506 unknown protein Potri.018G079700 16.58 0.9119
AT2G04030 Hsp88.1, AtHsp9... HEAT SHOCK PROTEIN 88.1, EMBRY... Potri.008G112700 18.11 0.9192
AT5G20720 CHCPN10, ATCPN2... CHLOROPLAST CHAPERONIN 10, cha... Potri.018G063200 19.67 0.9133 Pt-CPN21.2
AT1G62390 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1,... Potri.004G002900 23.95 0.8844
AT2G32650 RmlC-like cupins superfamily p... Potri.014G156900 26.15 0.9108

Potri.002G126800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.